KEGG   Halomonas sp. R57-5: HALO0855Help
Entry
HALO0855          CDS       T04029                                 

Definition
(GenBank) Aldose 1-epimerase-Galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ham  Halomonas sp. R57-5
Pathway
ham00010  Glycolysis / Gluconeogenesis
ham00052  Galactose metabolism
ham01100  Metabolic pathways
ham01110  Biosynthesis of secondary metabolites
ham01120  Microbial metabolism in diverse environments
ham01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ham00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HALO0855
   00052 Galactose metabolism
    HALO0855
Enzymes [BR:ham01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     HALO0855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CEP34537
UniProt: A0A0D6E4Y6
LinkDB All DBs
Position
I:919798..921039
Genome map
AA seq 413 aa AA seqDB search
MPLINTQVGAQKHSAGSTLLLSAGIALLMISAAQAQSETQATAGNGAENGVEKSVFGHLP
DGRQVDVYQFTNANGIELRVTNYGGIILSLKTPDMNGKFDDIALGFDSLEAYLSDEYRQA
NPYFGAIIGRYGNRIAGGQFPLDGESYSLATNDGSNHLHGGDQGFDKVLWQAEPFENEAG
TGLVLRYTSEDGEEGYPGRLETEVTYTLTDNDELMVDYRAVTDKATPINLTQHSYFNLKG
EGSDTILDHQLMINAPEFTPVNDSLIPTGEIRSVDGTPFDFTQAIPIGERIEQDNEQLAF
GGGYDHNFVLARDNAAADELVLAAKAWEPQSGRMVEITTTEPAIQFYSGNFLNGDLTGKQ
GQAYGHRSGFALETQHYPDSPNQEAFPSTILEPGDTYRSRTVYRFSAQQNFDS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgccactcataaatactcaggtaggcgctcagaaacatagcgcgggatcaacgctgctg
ctaagcgccggtatcgccctgctaatgattagtgcagctcaagcacaaagcgagactcag
gcgacagcgggaaatggcgccgaaaacggcgttgagaaatcggtgtttggccacttgccc
gatggtcgtcaggtcgatgtttaccaatttaccaacgccaacggtatcgaactgcgggtg
accaactacggcggcatcatcctgtcgctgaagacccccgatatgaacggcaaatttgac
gatatagcgctgggtttcgactccctggaagcgtacctttccgatgagtaccgtcaggca
aatccctatttcggtgccatcatcggccgttatggtaatcgtatcgcaggtggccaattc
ccccttgatggggaaagttactcgttggctaccaacgatggcagcaatcatctgcatggc
ggcgatcagggcttcgacaaagtgctgtggcaagccgaaccctttgaaaacgaagcgggc
actggattggtgttgcgctataccagcgaagatggcgaagagggctaccctggcaggctg
gagactgaagtcacctatacgctgaccgataatgacgaactgatggtggattatcgagcg
gtgaccgacaaagccaccccgattaacctcacccagcacagctacttcaacttaaaaggt
gaaggcagcgacaccattcttgatcatcagttgatgatcaacgcccctgaatttaccccg
gttaacgacagcctgattcccactggcgagattcgctcggtagacggcacgccgttcgac
tttacccaggcgattcccatcggcgaacgcattgagcaagacaatgagcagctcgccttc
ggcggcggttatgaccacaactttgtgcttgcccgcgataacgcggcagcggatgaactg
gtgctggctgccaaggcgtgggagccgcagagcggacgcatggtggaaatcaccaccacc
gaacccgcgatccagttctattccggcaactttcttaacggcgacctgaccggtaagcag
gggcaggcttacggacaccgttctggctttgcgttggaaacccagcactaccccgattct
cctaatcaggaggcgtttcccagcacgatcctagagccaggcgatacttaccgctcgcgt
acggtataccgcttttcggcgcaacagaattttgattcataa

DBGET integrated database retrieval system