KEGG   Halomonas sp. R57-5: HALO1189Help
Entry
HALO1189          CDS       T04029                                 

Definition
(GenBank) Alcohol dehydrogenase superfamily, zinc-containing
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ham  Halomonas sp. R57-5
Pathway
ham00010  Glycolysis / Gluconeogenesis
ham00071  Fatty acid degradation
ham00350  Tyrosine metabolism
ham00625  Chloroalkane and chloroalkene degradation
ham00626  Naphthalene degradation
ham01100  Metabolic pathways
ham01110  Biosynthesis of secondary metabolites
ham01120  Microbial metabolism in diverse environments
ham01130  Biosynthesis of antibiotics
ham01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ham00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HALO1189
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HALO1189
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    HALO1189
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HALO1189
   00626 Naphthalene degradation
    HALO1189
Enzymes [BR:ham01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HALO1189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CEP34871
UniProt: A0A0D6E543
LinkDB All DBs
Position
I:1296179..1297207
Genome map
AA seq 342 aa AA seqDB search
MDSTMRAAVVREFGQPLVIEEVDVPRPKQGEVLMKVAASGVCHTDLHAAHGDWPVKPSPP
FIPGHEGVGHIVAVGAGVTHVKEGDRIGVPWLYSACGYCEHCLGGWETLCESQQNTGYSV
NGGFADYTLADAGYVGRLPDAIDFIEIAPVLCAGVTVYKGLKMTDTRPGQWVVISGIGGL
GHMAVQYAKAMGLNVAAVDIDDGKLALAERLGATVTVNAMNTDPAAYLKKTIGGAHGALV
TAVSPKAFDQAQNMLRRGGTLVLNGLPPGDFPLPIFSTVLNGITIRGSIVGTRSDLQEAL
DFAAEGKVKATVATDTLDNINDIFQRMIDGKIEGRIVLDMAS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggatagcacaatgcgcgcggcggtcgttcgtgagtttggccagccgttggtcatagaa
gaagtcgacgtacctcgccctaagcagggcgaagtgttgatgaaagtggcggcctctggg
gtttgccataccgatttacacgccgcccacggcgattggccggtgaaaccctcgccgcca
tttattcccggccatgaaggcgttgggcatatcgtggcggtgggtgcaggtgtcacccat
gtcaaagagggggatcgtatcggcgtaccctggctctactcggcctgtggctactgcgag
cactgtttgggcggttgggaaaccctgtgtgagtctcagcaaaataccggctacagcgtt
aacggtgggtttgccgactacaccttagcggatgcgggctatgttgggcgcctgccggat
gccatcgacttcattgaaatagctccggtgctgtgtgcgggagtgacggtttataaaggc
ttgaaaatgaccgatacccgccccggccagtgggtggtgatttcgggcattggtggtctg
ggccatatggcggtgcagtacgccaaagccatggggctgaatgttgccgcggtggatatc
gatgatggaaagctagccctggccgagcgcttaggcgctacggtaacggttaacgccatg
aacaccgacccggcggcgtacttgaagaaaaccatcggtggcgctcacggtgccttggtc
acagcggtatcgccgaaggcgtttgatcaggcgcagaatatgctacgccgcggcggaacg
ttggtgctcaatggcttaccgcccggcgacttcccgctgccgatcttcagcacggtgctc
aacggtattaccattcgtggctctatcgtcggcacgcggagtgatttgcaggaggcgctg
gattttgccgccgaaggcaaggtcaaagcgacggtagcaaccgatacgctggacaatatc
aacgacattttccagcgcatgatcgacggcaagatagaaggccgtattgtgcttgatatg
gcgagctga

DBGET integrated database retrieval system