KEGG   Halomonas sp. R57-5: HALO1803Help
Entry
HALO1803          CDS       T04029                                 

Definition
(GenBank) Alkyl hydroperoxide reductase, subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ham  Halomonas sp. R57-5
Brite
KEGG Orthology (KO) [BR:ham00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HALO1803
Enzymes [BR:ham01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HALO1803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 Glutaredoxin HI0933_like FAD_oxidored K_oxygenase Thi4 DAO FAD_binding_3 FMO-like DUF3467 YojJ NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CEP35485
UniProt: A0A0D6E7F0
LinkDB All DBs
Position
I:complement(1953769..1955325)
Genome map
AA seq 518 aa AA seqDB search
MLDANLKSQLKAYLEKVTQPFEIVASLDDGAKSQELLGLLEDISSLSDKITLHSDGQDDR
KPSFAINRPGEETGVVFAGIPMGHEFTSLVLALLQVGGHPPKTSDELLKQIKELDGEMLF
ETYYSLSCQNCPDVVQALNLMAIFNPKVRHVAIDGALFQDEVESREIMSVPSIYLNGKPF
DQGRMTLEQILAKVDTGAAERDAKKLSEKAAFDTLVIGGGPAGAAAAIYSARKGINTGIA
AERFGGQVADTMGIENFISVSHTEGPKLVSALEEHVKDYEVDVMNLQLATTFKAAEAEGG
LHEVTFESGATLKSKTLVLATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVGHVTLVEFMGEMRADAVLQKKLKSLPNVEIILNAQTTEVTGDG
SRVNGLNYKDRTSDESKSIALEGIFVQIGLVPNTEWLKGSPIEMTPRGEIIVDAHGMTSV
PGVFAAGDVTTVPYKQIIIAMGEGAKASLGAFDYLIRN
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatttaaaatcccagttaaaagcgtatctggaaaaagtgactcagccg
ttcgagattgttgcctccctcgatgacggtgccaagtcacaagaacttctcggcctgctt
gaggacatcagcagcctgagcgataagattactctacacagtgacggccaggacgaccgc
aagccatcgtttgcaatcaaccgccccggcgaagagacgggcgtggtgtttgctggcatc
cccatgggccacgagttcacatcgctggttttagcgctgctgcaagtcggcggccatcca
cccaaaacctctgatgagctactcaagcaaattaaagagctcgacggcgagatgcttttc
gagacttactactcgctctcctgccagaactgccctgacgtggttcaagcgcttaacctg
atggctattttcaacccgaaggtgcgccatgtcgctatcgacggcgcgctgttccaggat
gaagtcgagtcgcgggaaatcatgtcggtaccgagcatctacctgaacggtaaaccgttc
gatcaaggccgcatgacccttgaacagattctggccaaggtggataccggtgccgcggag
cgcgatgccaaaaagctaagtgaaaaagccgctttcgatacgctggtgattggtggcggc
ccggcaggcgcggcggccgccatttactcagcccgtaaaggtattaacacaggcattgcc
gctgagcgtttcggtggtcaggtggctgacacgatgggaattgaaaactttatctccgtc
tcccataccgaaggccccaagctggttagcgcgcttgaagagcacgtaaaagattacgaa
gtcgatgtcatgaacctgcaacttgccactacctttaaagccgccgaagcggaaggtggt
ttgcacgaagtcacttttgagtccggcgcgacgcttaagagcaaaaccctggtattggcg
acgggcgcccgctggcgcgaaatgaatgtgcccggcgaacagcagtaccgcaataaaggg
gtggcctactgccctcactgtgacggcccgctgttcaaaggtaaacgggtagcggtgatc
ggcggcggtaactctggcgttgaagcggcgatcgatctggcgggtattgtcggccatgtc
acgctggtagagtttatgggtgagatgcgcgccgatgcagtgctgcagaaaaagcttaag
agcctgcctaacgtcgagattattctcaacgcacaaaccactgaagtcactggtgatggt
agccgtgttaatggcttgaactataaagaccgcacgtctgatgagagcaaatccatcgcg
ctggaaggtatctttgttcagattggtctggtgcctaacaccgagtggttaaaaggctca
ccgattgagatgacgccccgcggtgagatcatcgtcgatgctcacggtatgacctccgta
cctggggtattcgccgcgggcgatgtgactaccgtgccttataagcagatcattattgcc
atgggagaaggcgccaaggcatcgttgggtgctttcgactacttaattcgtaattga

DBGET integrated database retrieval system