KEGG   Halomonas sp. R57-5: HALO3233Help
Entry
HALO3233          CDS       T04029                                 

Definition
(GenBank) Malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
ham  Halomonas sp. R57-5
Pathway
ham00020  Citrate cycle (TCA cycle)
ham00270  Cysteine and methionine metabolism
ham00620  Pyruvate metabolism
ham00630  Glyoxylate and dicarboxylate metabolism
ham00680  Methane metabolism
ham01100  Metabolic pathways
ham01110  Biosynthesis of secondary metabolites
ham01120  Microbial metabolism in diverse environments
ham01130  Biosynthesis of antibiotics
ham01200  Carbon metabolism
Module
ham_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ham_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ham_M00012  Glyoxylate cycle
ham_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ham00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HALO3233
   00620 Pyruvate metabolism
    HALO3233
   00630 Glyoxylate and dicarboxylate metabolism
    HALO3233
  Energy metabolism
   00680 Methane metabolism
    HALO3233
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HALO3233
Enzymes [BR:ham01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     HALO3233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: CEP36915
UniProt: A0A0D6EBH1
LinkDB All DBs
Position
I:complement(3503960..3504934)
Genome map
AA seq 324 aa AA seqDB search
MKDPVRIAITGGAGQISYSLIFRIAAGDMLGPDQPVILQLLEIPQAMDALNGVVMEVNDC
AFPLVQDIVATDDPNVAFKDADFALLVGARPRGPGMERKDLLEANAAIFSVQGKALNDHA
SRDVKVLVVGNPANTNALIASCNAPDLDAGQFTAMTRLDHNRALTQLAQKTGKHVTDVEN
MIIWGNHSATQYPDLAQCKVDGKAAFDLVERDWYENDFIPTVQQRGAAIIKARGASSAAS
AASSAIDHMHDWALGSKGIVSMAIPSDGSYGIEEGIIYSYPVRCQGGKYEIVQGFEIDEF
SQEKMKATEKELREERAAVEHLLG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatccagtacgtattgcgattaccggcggcgccggtcagatcagctactcactt
attttccgcatcgctgcaggcgacatgttggggccggatcagccagtcattctccagctg
ctcgaaattccccaggcaatggacgccctgaacggcgtggtaatggaagttaacgactgt
gctttcccgctggttcaagacatcgtcgcaactgatgacccgaacgtcgcgttcaaagac
gctgacttcgctctgctggtaggtgcacgtccgcgtggcccaggcatggagcgtaaagat
ctgctggaagccaacgccgcgatcttctccgtacaaggtaaagcattgaacgatcacgct
agccgtgatgtgaaagtgctggtcgtgggtaacccggctaacaccaacgcgctgatagct
tcctgcaacgcgccagatctggacgcaggccagttcaccgcgatgacgcgtttggaccac
aaccgcgccctgacccagctggcacagaaaaccggcaagcacgtcactgacgttgaaaac
atgatcatctggggcaaccacagtgccacccagtatccggatctggcccagtgcaaagtc
gacggcaaagcagcgttcgatctggttgagcgcgactggtacgaaaacgacttcatcccc
actgtgcaacagcgcggcgcggcaatcatcaaagcacgtggcgcctcttcagccgcttct
gctgcttcttccgccatcgaccacatgcacgactgggcgctgggctccaaaggcatcgtc
agcatggcaattccgtctgacggcagctacggcatcgaagaaggcatcatctactcctac
ccagtgcgttgccagggtggcaagtatgaaatcgttcaaggcttcgaaattgacgaattc
agccaagagaagatgaaagccaccgagaaagaactgcgcgaagagcgtgcagccgtcgag
cacctgctcggctaa

DBGET integrated database retrieval system