KEGG   Halomonas sp. R57-5: HALO3399Help
Entry
HALO3399          CDS       T04029                                 

Definition
(GenBank) Succinate dehydrogenase/fumarate reductase iron-sulfur prot
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ham  Halomonas sp. R57-5
Pathway
ham00020  Citrate cycle (TCA cycle)
ham00190  Oxidative phosphorylation
ham00650  Butanoate metabolism
ham01100  Metabolic pathways
ham01110  Biosynthesis of secondary metabolites
ham01120  Microbial metabolism in diverse environments
ham01130  Biosynthesis of antibiotics
ham01200  Carbon metabolism
Module
ham_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ham_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ham_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ham00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HALO3399
   00650 Butanoate metabolism
    HALO3399
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HALO3399
Enzymes [BR:ham01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HALO3399
    1.3.5.4  fumarate reductase (quinol)
     HALO3399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: CEP37081
UniProt: A0A0D6EBC9
LinkDB All DBs
Position
I:complement(3700321..3701031)
Genome map
AA seq 236 aa AA seqDB search
MSNLQVSVYRYNPETDSAPYMQEFQVDTKGRDVMVLDVLHMMKEQDSGLAFRRSCREGVC
GSDGMNMNGKNGLACITPLSDVVKNNKLTLRPLPGLPVIRDMVVDMGLFYKQYERIQPYL
QNDTPAPAIERLQSPEERDKLDGLYECILCACCSTSCPSFWWNPEKFVGPAGLLQSYRFL
ADSRDTATSERLSNLEDPFSVFRCRGIMNCVAVCPKGLNPTRAIGKIREMLLADAT
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatcttcaggtatccgtataccgctacaatccggaaaccgactccgcaccttac
atgcaggagtttcaggtcgataccaaaggccgcgatgtgatggtgctggatgtccttcat
atgatgaaggagcaagacagcggtttggcgtttcgtcgcagctgccgtgaaggcgtctgc
ggttcagacggcatgaacatgaacggcaaaaacggcttggcctgtatcacgccgctgtca
gacgttgtcaaaaacaacaagctgaccctgcgcccgctaccgggcttgccggttattcgc
gatatggtcgtcgatatggggctgttctataagcagtacgagcgtattcagccgtacctg
cagaacgacacgcctgcgccggccattgagcgcctgcagtcgccagaagaacgcgacaag
cttgatggcttgtatgagtgtattctgtgcgcatgctgttcaacgtcttgcccgtcgttc
tggtggaaccccgagaagttcgttggcccggcgggtctgctgcagtcataccgcttcctg
gccgattcacgtgacacggccaccagcgagcggttgagcaacctggaagatccgttctcg
gtattccgttgccgtggcattatgaactgtgtagcggtgtgcccaaaagggcttaaccct
acccgggcaattggtaaaattcgcgaaatgttactcgctgatgctacctaa

DBGET integrated database retrieval system