KEGG   Halomonas sp. R57-5: HALO4418Help
Entry
HALO4418          CDS       T04029                                 

Definition
(GenBank) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
ham  Halomonas sp. R57-5
Pathway
ham00061  Fatty acid biosynthesis
ham01100  Metabolic pathways
ham01212  Fatty acid metabolism
Module
ham_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ham00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HALO4418
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ham01004]
    HALO4418
Enzymes [BR:ham01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     HALO4418
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     HALO4418
Lipid biosynthesis proteins [BR:ham01004]
 Fatty acid synthase
  Component type
   HALO4418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: CEP38100
UniProt: A0A0D6EER7
LinkDB All DBs
Position
I:4823203..4823718
Genome map
AA seq 171 aa AA seqDB search
MTKQHSFDREELLACSRGELFGPGNAQLPAPNMLMLDRIRHIHKEGGEHGKGELIAELDI
TPDLWFFDCHFPGDPVMPGCLGLDAMWQLVXFYLGWLGHPGRGRALGCGEVKFSGQILPD
AQKVTYSINIKRIITRRLILGIADGTVTVDGRDIYQANDLRVGLFTSTANF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagcaacactcctttgatcgcgaagaactgctggcctgctcccgcggcgagcta
ttcggccccggcaatgcacagctcccggcccccaacatgctaatgcttgatcgcatcagg
cacatccataaggaaggcggtgagcatggcaaaggcgagctgatcgccgagctggatatc
acgccggacctgtggttctttgactgccattttcccggcgaccccgttatgcctggctgt
ttaggactagatgctatgtggcagctagtckggttttatttgggctggctgggccatcca
ggtcgcggacgtgcgcttggctgcggtgaagttaaattcagcggccagattctgccagat
gcacaaaaagtgacctatagcattaatattaagcgtattattacccgacgtcttatcttg
ggtatcgccgacggcacggtaaccgttgacgggcgcgacatctatcaggctaatgatctg
cgcgttggcctatttacctccactgcgaatttctga

DBGET integrated database retrieval system