KEGG   Halomonas sp. R57-5: HALO4419Help
Entry
HALO4419          CDS       T04029                                 

Definition
(GenBank) 3-oxoacyl-synthase 1
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
ham  Halomonas sp. R57-5
Pathway
ham00061  Fatty acid biosynthesis
ham00780  Biotin metabolism
ham01100  Metabolic pathways
ham01212  Fatty acid metabolism
Module
ham_M00083  Fatty acid biosynthesis, elongation
ham_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ham00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HALO4419
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HALO4419
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ham01004]
    HALO4419
Enzymes [BR:ham01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     HALO4419
Lipid biosynthesis proteins [BR:ham01004]
 Fatty acid synthase
  Component type
   HALO4419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N CaMKII_AD
Motif
Other DBs
NCBI-ProteinID: CEP38101
UniProt: A0A0D6EEB4
LinkDB All DBs
Position
I:4823732..4824949
Genome map
AA seq 405 aa AA seqDB search
MRRVVVTGLGIVSCLGNDQRQVLDALKTGRSGIRFKEEYAERGFRSHVAGSVDIDLDALI
DRKLRRFMGDAAAYAYVSMAQAIEDAGLSEEQVSNQRTGLIAGSGGASSANQVEAADVLR
DKGLRRVGPYRVTRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGSAMEQIQLNKQ
DVVFAGGGEEEHWTLSCLFDAMGALSTHYNDTPEQASRPYDQARDGFVIAGGGGMLVLEE
LEHAKARGAKIYGELVGYGATSDGHDMVAPSGEGAMRCMRQAMATVDGSIDYINTHGTST
PVGDVAELKAIREVFGNTTPAMSSTKSLTGHSLGATGVQEAIYSLLMMQHNFVAASANIT
DLDEQADGFDIVTERRDDVTIERALSNSFGFGGTNACLVFQRFND
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgagtggtagtcaccggccttggcatcgtatcgtgccttggcaacgaccaacga
caggtcctggacgcgctcaaaactgggcgtagtggtattcgttttaaggaagagtatgcc
gagcgtggcttccgtagccatgtggcaggcagcgtcgatattgatcttgacgcactcatc
gaccgcaaactgcgccgttttatgggcgatgcagcggcctatgcctatgtctctatggcc
caagccatcgaagacgcggggctgagcgaagaacaagtatccaaccaacgtactggcctg
atcgccggctccggcggtgcttcaagcgctaaccaggttgaagctgccgatgtactgcgt
gacaaaggcctgcgccgcgttggcccttaccgcgttacccggacaatgggcagcaccgtt
tccgcctgtttggctacgccgtttaaaatcaaaggcgtcaattactctatctcttctgcc
tgtgcgacatctgcgcactgtattggcagcgcgatggagcaaattcagcttaacaagcag
gatgtggtgtttgccggtggcggtgaagaggagcactggacgctctcttgcctatttgat
gccatgggcgcgctctctacccactacaacgacacacctgagcaggcttcacgtccttac
gaccaggcccgcgacggttttgttatcgccggtggcggtggcatgctggtgttagaagag
cttgaacacgctaaagcccgcggcgccaagatctacggcgaactggtgggttacggcgcg
acctctgacggccatgatatggtcgctccttcgggcgaaggggccatgcgctgtatgcgc
caagcgatggcaacggtcgatggcagcattgattacatcaatacccatggcacttcgacc
cccgtcggcgatgttgccgagctgaaggcgatacgcgaagtgtttgggaatacaacaccc
gccatgagctcgaccaaatcgctcaccggccactccttgggagctaccggtgtacaggaa
gcgatctactcgctgctgatgatgcaacacaactttgttgccgcctcagcgaatatcacc
gatttggatgagcaggccgacggctttgatattgtcaccgaacgccgcgatgacgtgacg
atagaacgtgccttgtctaatagcttcggctttggcggtaccaatgcgtgtttagtcttc
cagcgtttcaacgactaa

DBGET integrated database retrieval system