KEGG   Helianthus annuus (common sunflower): 110865964Help
Entry
110865964         CDS       T05101                                 

Definition
(RefSeq) hexokinase-2, chloroplastic
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00010  Glycolysis / Gluconeogenesis
han00051  Fructose and mannose metabolism
han00052  Galactose metabolism
han00500  Starch and sucrose metabolism
han00520  Amino sugar and nucleotide sugar metabolism
han01100  Metabolic pathways
han01110  Biosynthesis of secondary metabolites
han01200  Carbon metabolism
Module
han_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
han_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110865964
   00051 Fructose and mannose metabolism
    110865964
   00052 Galactose metabolism
    110865964
   00500 Starch and sucrose metabolism
    110865964
   00520 Amino sugar and nucleotide sugar metabolism
    110865964
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110865964
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:han04131]
    110865964
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110865964
Membrane trafficking [BR:han04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110865964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 110865964
NCBI-ProteinID: XP_021971003
LinkDB All DBs
AA seq 493 aa AA seqDB search
MSTVLNPPPTLRSFRSPTPRSPRLSMLLRSTTLSTAAALPVLTKLQHDCATPLPLLRNIA
DNMAADMRAGLAVDGGSDLKMILSYVDSLPTGHERGLFYALDLGGTNFRVLRTQLGGRDE
RVIDTEFEQVSIPQDLMSGTSDELFDFIASALAKFVKKEGGKFVLPNGRSRETGFTFSFP
VKQTSIDSGILIKWTKGFSVSGTPGKDIVACLNEAMGRQGLDMRVSALVNDTVATLAGAR
YWDDDVMVAVILGTGTNACYVESVEAIPKLQGRKSTYGKTIINTEWGAFSNGLPLTEYDR
AMDAESINPGEQLYEKTISGMYLGEIVRRVLVRMAETGSLFGKHIPEKLQTPFALGTPNI
SSMQQDTSEDLEAVGSILYEATGVDSNLDARKMVVEVCDTIAKRGGRLAGAGIVGILQKM
EEDSKGVVFGKRMVVAMDGGLYEHYPQYKRYLKNAVAELLGPELSSHVVIEHSKDGSGIG
AALLAATNSIYEH
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgtcctcaacccaccaccaaccctccgatccttccggtcacccactccccgc
tcgccacgtctctccatgctcctccgatccaccaccctctccaccgccgcagcccttcct
gtactcaccaagttgcaacacgactgcgccacccctctcccacttctccggaacattgcc
gacaacatggcggccgacatgcgtgctggtcttgctgttgacggcggtagtgatcttaag
atgatccttagctatgttgattctctgcctactgggcatgaaagagggttgttttatgcg
ttggacctcggtggtacgaatttccgagttcttagaactcagttaggaggaagggatgag
cgggtgatcgataccgaatttgagcaagtttctataccacaagacttaatgtctggcacc
tctgacgaactttttgattttatcgcatccgcgttagcaaaattcgtgaagaaagagggt
ggaaagtttgtgttgccaaatggtagaagtagagagacagggtttaccttttcttttcct
gtgaagcaaacctccattgattccggaatactaatcaagtggacaaaggggttttccgtc
tcaggaacgcctggtaaggacattgtagcgtgtttaaatgaagccatgggaaggcaaggg
cttgatatgcgtgtttctgctttggttaatgatacggttgcaacactagccggagcaaga
tactgggacgatgatgtcatggttgcggtaattcttggaaccggaaccaatgcttgctat
gtagaatccgtggaagccattcctaaactacaaggccgtaaatctacttatggaaaaacg
attataaataccgagtggggagcattctcaaacggtctacctttgaccgagtatgataga
gcaatggacgccgagagtataaaccctggagaacaattatatgaaaagacaatctcgggc
atgtatcttggcgaaattgtgagacgggtacttgtgaggatggctgaaaccggttcattg
tttggaaaacatattcccgaaaagctacaaactccgtttgctctcgggaccccaaatata
agttctatgcagcaggatacttctgaagatcttgaagcagttggatcaatcctctatgaa
gccacaggggttgactcaaatttggacgcgagaaagatggtggtggaggtttgcgacaca
atcgcaaagcgtgggggccgcttggccggagcaggaatcgttggaatactccaaaagatg
gaggaggattccaagggtgtcgtttttggaaaacgtatggttgttgctatggatggaggt
ctatacgaacactaccctcaatacaagcgataccttaaaaatgcggtagcggaacttcta
ggtcccgagttatcgagtcatgtagttatcgagcattcgaaagatggatccggtattgga
gctgcactcttggctgctacaaattctatttatgaacattga

DBGET integrated database retrieval system