KEGG   Helianthus annuus (common sunflower): 110872100Help
Entry
110872100         CDS       T05101                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00010  Glycolysis / Gluconeogenesis
han00020  Citrate cycle (TCA cycle)
han00620  Pyruvate metabolism
han01100  Metabolic pathways
han01110  Biosynthesis of secondary metabolites
han01200  Carbon metabolism
Module
han_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110872100
   00020 Citrate cycle (TCA cycle)
    110872100
   00620 Pyruvate metabolism
    110872100
Enzymes [BR:han01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     110872100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF1204
Motif
Other DBs
NCBI-GeneID: 110872100
NCBI-ProteinID: XP_021976560
LinkDB All DBs
AA seq 475 aa AA seqDB search
MSSSLLQSRVPPQLSFTSSLNKSQWRFTTLPAVTFTRRAKHATVNAKIREIFMPALSSTM
TEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVPEGESAPVGAPIG
LLAETEAEIEEARAKAASSGSSPATPPPAAPQAPAAAAVAPAPAPTPVAAAAVADGPRKI
VSTPYAKKLAKQHKVDINKVVGTGPFGRITPADVEAAAGIVPVKSVAPVVAEPVAAAAAA
PVKSAPALPDIPGATIVPFTTMQAAVSKNMIESLSVPTFRVGYPVMTDALDALYAKVKSK
GVTMTALLAKAAAMALVQHPVVNASCKDGKSFTYNSSINIAVAVAINGGLITPVLQDADK
LDLYLLSEKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVG
ASKPTPIADKDGYFSVKSQMLVNVTADHRIVYGADLAAFLKTFAKIVQEPDSLTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttctctcctccaatctagggttccaccacaactctccttcacttcatcactc
aacaaatcgcaatggcgcttcaccactctccccgccgttacattcacgcgccgcgcaaaa
cacgcaactgtcaacgccaaaatcagagagatcttcatgcctgcactcagctccaccatg
accgagggcaaaatcgtctcctggatcaaatcagaaggtgatgttctctccaaaggtgag
tctgttgttgttgttgaatctgataaagctgatatggatgttgaaacgttttacgatgga
attttggctgctattgttgttcctgagggtgaatcggctcctgttggagctccgattggc
cttttagctgaaaccgaagccgaaattgaagaagctagggctaaagccgctagttctggc
tcttctccggctactccgccgccggctgcaccacaggctccggctgctgcggctgtggct
ccagctccggctccaacaccggttgcggctgctgcggttgcggatggaccgaggaagatt
gtttcgacgccgtatgcgaagaaattggcgaaacagcataaggtggatattaataaggtg
gtagggactggaccgtttgggaggattactccggctgatgtggaagctgctgctggaatt
gtgccggttaaaagtgtggctccggttgtggcggaacctgtggctgctgctgcagctgct
ccggttaaatcggcacctgcattgccggatatacctggggcgactattgtgccgtttacg
acgatgcaagctgcggtgtcgaagaatatgattgagagtttgtctgtgccgacgtttcgc
gttgggtatcctgttatgacagatgcgcttgatgctctgtatgcgaaggttaagtctaag
ggtgtgacgatgactgctttgctagcaaaggctgctgcaatggcacttgttcaacaccct
gtggtgaatgcaagttgtaaggatggaaagagttttacttataacagcagcattaatatc
gctgtggctgtggctatcaatggcggtttgatcacccctgttctccaggatgctgacaag
ttggatctttatctgctatctgagaagtggaaggagcttgtggagaaagcacgatctaag
cagctacagccccatgaatacaattcagggacttttactctctccaacttaggcatgttt
ggagtggatcgctttgatgctattctaccacctgggcagggggctattatggctgttgga
gcttcaaagcctactcctattgctgataaggatggatatttcagtgtgaaaagtcaaatg
ctggttaatgtaactgctgatcacagaattgtatacggagctgacttggctgccttcctt
aaaacctttgcaaagatcgttcaagaacccgatagcttgacattgtaa

DBGET integrated database retrieval system