KEGG   Helianthus annuus (common sunflower): 110872439Help
Entry
110872439         CDS       T05101                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00564  Glycerophospholipid metabolism
han01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110872439
Enzymes [BR:han01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     110872439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA Lycopene_cycl NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 110872439
NCBI-ProteinID: XP_021976929
LinkDB All DBs
AA seq 632 aa AA seqDB search
MASFFRARRVGYTAALSVALGGSYVTLRHPYASSNDRNIGGSALDTVHKKITDPAAVIPS
RASQQSSLIAANSSNPLDILVVGGGATGCGVALDAVTRGLRVGLVERDDFSSGTSSRSTK
LIHGGVRYLEKAVFNLDYGQLKLVFHALEERKQVIDNAPHLCHALPCMTPCFSWFEAVYY
WVGLKMYDLVAGKHLLHLSRYYSAQESAELFPTLARKGKDRSLKGTVVYYDGQMNDSRVN
VGLACTAALAGASVLNHAEVVSFIKEDGGEQIIGARIRDNLSGTEFDAYAKVVVNAGGPF
CDSVRKLADKDAKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAG
TTDSNTSITMLPEPHEDEIEFILDAICDYLNVKVRRTDVLSAWSGIRPLAVDPNAKNTES
ISRDHVVCEDVPGLVTITGGKWTTYRGMAEDAVDAAIKSGKLNPKNKCLTSNVHLVGGDG
WDPAYFTVLSQEYVRMKVSHTGKVVPGVMDTAVAKHLSHSYGTMAEKVAAIAQNENLGKR
LAHGYPYLEAEVAYCARNEYCESATDFIARRSRLAFLDTDAAGRAVPRVIQILASEHQWD
KGRQKQELESATKFLESFKSSKNAQFHDGKHT
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctttttccgcgctcggcgcgtaggctacaccgccgcactctccgtcgcgctc
ggcggttcctacgtcaccctccgtcatccatacgcatcctccaacgaccgtaacatcggc
ggttcagccctagacacagtccataagaagatcaccgatccggctgcggttattccatcg
cgtgcgtcacaacaatcgtctctaatcgctgcaaattcttcgaatccgctcgacattctt
gttgttggcggtggagccaccggatgtggcgttgctcttgacgctgttactagaggcctt
agggttggtctggtggaacgggatgatttttcttctggaacgtcgtctagatctacgaag
ttgattcatggaggtgttcgctacttggaaaaagccgtgttcaatctagattacgggcaa
ctaaagctagtttttcatgcactagaggaacgcaaacaggttatcgataacgcaccacac
ctctgtcatgctttaccctgcatgacaccatgttttagctggtttgaggcagtatactat
tgggtgggcttaaaaatgtatgatctagtggcaggaaaacatttacttcacttatctaga
tattactctgcacaagagtccgccgaactcttccctacattagcaagaaaaggcaaagat
agaagtttaaagggaacagtagtatattatgatggacaaatgaatgattcgcgggttaac
gttggattagcatgtactgctgcattagcaggcgcttctgttcttaatcatgctgaagtt
gtatcctttattaaggaagatggcggggaacagataataggtgctcgtattcgggacaac
ttatcaggcacagagttcgatgcatacgcaaaagtggtggttaatgcaggtggaccattt
tgtgactctgttcgaaaactggctgataaagacgcaaaaccgatgatctgtccgagtagc
ggtgtgcacattgtgttgcctgactattattctccggagggaatgggtctaatcgttccg
aaaacgaaagacggacgtgttgtgttcatgctcccatggttaggaagaacagttgctggt
acaaccgactccaataccagcattaccatgcttcccgaacctcatgaggatgaaatcgaa
tttatacttgatgccatatgtgattatctcaatgttaaggtacggcgcacagatgtcctg
tctgcttggagtggtattcggccattggcggtagatccaaacgcaaagaatacagagagt
atttcacgagatcatgttgtgtgtgaagatgttcccggattggtcactattactggtgga
aagtggaccacatatcgaggcatggctgaagatgcagttgatgcagctatcaaatctggt
aaactgaacccgaaaaacaagtgtttgacatcgaatgtacatctagtgggcggagatgga
tgggatcctgcgtattttacggtgctttcccaagaatatgtgcggatgaaggtgtcgcat
acaggaaaagttgttcctggagtcatggatactgctgttgctaaacatttgtcgcattct
tatggtaccatggctgaaaaagtagctgccatagctcagaatgaaaatcttggcaagcgg
cttgctcatgggtacccgtaccttgaagctgaggtggcgtactgtgctcgaaatgaatat
tgtgaatctgcgacagattttattgctaggagatcccgacttgcttttctcgatactgat
gcagcgggccgagcagtgccacgtgtcatacagatactggcttccgaacatcaatgggac
aagggaaggcagaagcaagagttggagtcagcaacaaagtttctagaatcttttaagtca
tcgaagaatgctcaatttcatgatgggaagcatacatag

DBGET integrated database retrieval system