KEGG   Helianthus annuus (common sunflower): 110873143Help
Entry
110873143         CDS       T05101                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:han00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110873143
Enzymes [BR:han01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     110873143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 110873143
NCBI-ProteinID: XP_021977760
LinkDB All DBs
AA seq 153 aa AA seqDB search
MVKAVAVLSSSEGVSGTIFFNQEAEGAPTTVTGDLSGLKPGPHGFHVHALGDTTNGCMST
GPHYNPHGKEHGAPDDEVRHAGDLGNVTVGEDGTAKFTIVDKQIPLIGAQSIVGRAVVVH
ADADDLGKGGHELSKSTGNAGGRVACGIIGLQG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggcggttgcggttcttagcagcagtgagggtgttagcggcaccatcttcttc
aatcaagaggcagaaggtgctcccactaccgttaccggagacctttctggcctcaaacct
ggacctcatggtttccatgttcatgcacttggtgacacaaccaatgggtgcatgtcaact
ggtcctcactacaatcctcatggaaaggagcatggtgcccccgatgatgaggttcgccat
gccggtgatcttgggaatgtcaccgtaggcgaagatggtactgcaaaattcaccattgtt
gataagcagattccactgattggagctcaatccatcgttgggagggcagtagttgttcat
gctgatgctgacgatcttggaaagggaggccatgagctcagcaaaagcacaggaaatgct
ggtggaagagttgcatgcggtatcattggattgcagggttga

DBGET integrated database retrieval system