KEGG   Helianthus annuus (common sunflower): 110877752Help
Entry
110877752         CDS       T05101                                 

Definition
(RefSeq) nitrilase-like protein 2 isoform X1
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110877752
Enzymes [BR:han01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     110877752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 110877752
NCBI-ProteinID: XP_021981640
LinkDB All DBs
AA seq 288 aa AA seqDB search
MAVNSVRIAAAQMTSINDLATNYATCARLVKEAASAGAKLLCFPENFSFVGAKDGESLKI
AEPLDGPILKGYCALARESNMWLSLGGFQERGSDDAHLCNSHVLIDDAGNIRSTYKKMHL
FDVDVPGGAVYKESSFTEAGKEIVAVDSPFGRLGLTVCYDLRFPEVYQQLRFHHGAQVLL
VPAAFTKVTGEAHWEVLLRARAIETQCYVIAAAQGGKHSEKRESFGDTLIIDPWGTVIGR
LPDRASTGIVVADIDFSLIESVRTKMPISQMLYAKDSYWPFPASTESP
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcaactccgtccgtatcgccgccgctcagatgacatccatcaatgatctcgcc
accaattacgccacctgcgctcgtctcgtcaaggaagcagcttcagcaggggcaaaactt
ctttgcttccctgagaatttctcatttgttggtgcaaaggatggggaaagccttaaaatt
gcggaaccgttagatggaccgatcctgaaaggatattgtgctcttgcaagggagtcgaac
atgtggctgtcgcttggagggtttcaagaacgagggtcagatgatgcgcacttgtgtaat
tcacatgttttgattgatgatgctggaaacattagaagcacctataagaagatgcatttg
tttgatgtggatgttcctggaggtgcagtctataaggagagcagctttacagaagcaggt
aaggagatagttgctgtggatagcccctttggacgtttgggcctaactgtatgttatgat
ttgcggttccctgaggtttatcaacaactacggttccaccatggagcacaggttttgtta
gttcctgctgcctttacaaaagtaactggtgaggcacattgggaggttcttcttcgtgcc
cgtgccatagagactcagtgttatgtgatagccgctgcacaaggcgggaaacatagtgaa
aaaagagagagctttggtgatacactgatcattgatccatgggggacagtaattggtcgt
ttaccagatagagcttcaactgggattgttgttgcagatatagatttctcattgatcgaa
tcagtgagaacgaagatgccaatatcccagatgctttatgctaaggattcatattggcct
tttcctgctagcaccgaaagcccatag

DBGET integrated database retrieval system