KEGG   Helianthus annuus (common sunflower): 110878879Help
Entry
110878879         CDS       T05101                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00020  Citrate cycle (TCA cycle)
han00190  Oxidative phosphorylation
han01100  Metabolic pathways
han01110  Biosynthesis of secondary metabolites
han01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110878879
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110878879
Enzymes [BR:han01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110878879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 110878879
NCBI-ProteinID: XP_021982959
LinkDB All DBs
AA seq 629 aa AA seqDB search
MWRCVSRGLRIPSRRSTSGGSFSHRFFSSESKAGGSAYTIVDHTYDAVVVGAGGAGLRAA
IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD
AIQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACAADRTG
HALLHTLYGQAMKHNTQFFVEYFALDLIMGSDGSCQGVIALNMEDGTLHRFRASSTILAT
GGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEGG
ILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPMKDHIYLHLNHLPPEVL
KERLPGISETAAIFAGVDVTKQPIPVLPTVHYNMGGIPTNYHGEVVTIKGSDPDAVVPGL
MAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHRPGETQKPLPKDAGEKTIAW
LDKIRNSNGSLPTSKIRLNMQRIMQNNAAVFRTQETLEEGCNLIDKAWESYHDVKLKDRT
LIWNSDLLETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWEN
EKVRLDYRPVHMNTLDDEVETFPPKARVY
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtatcacgtggtcttcgcattccatcccggagatccacctccggcggt
tctttttcacacagattcttctcatctgaatcgaaagctggaggatcagcgtatacgata
gttgatcatacatacgatgcggttgtggttggagcaggaggtgcgggtttacgagctgca
attggtctatctgagcatggctttaatactgcttgtatcactaagctgtttccaactcgt
tctcacactgttgccgctcagggtggtataaatgcagcattaggaaacatgaccgaggat
gactggaggtggcacatgtatgacaccgttaagggaagcgattggctaggtgatcaggat
gctatccagtatatgtgtagagaagcaccaaaagcagttattgagcttgaaaattatggt
ttaccattttctcgaactgaggagggaaagatttaccaacgtgcatttggtggtcagagt
cttgacttcgggaaaggtggacaagcttatcggtgtgcttgtgctgctgatagaactggg
catgcattattgcatacattgtatggtcaggccatgaaacataatacacagttctttgtg
gaatattttgcattggatctaatcatgggtagtgatggtagctgccaaggtgttattgct
ctgaacatggaagatggaacactacatcgcttccgtgcttcatcaacaatattggcaact
gggggttacggcagagcctatttctcagcaacctctgctcatacttgcactggagacgga
aatgctatggttgcacgtgcagggcttccccttgaggatcttgagtttgtacaatttcat
ccaactggtatatatggtgctgggtgcctcatcactgaaggatcacgtggtgaaggtggt
attttaaggaacagtgaaggtgaaagatttatggagcgctatgcccctacggcaaaggat
cttgcatcaagagatgttgtttcaagatctatgaccatggaaatccgtgaaggtcgtggt
gtaggaccgatgaaggaccacatttatcttcacttgaatcacctaccaccagaggttctc
aaggagaggcttccgggtatctctgaaactgctgccatttttgctggtgttgatgttaca
aagcaaccaattccagttttacccactgtgcattacaatatgggtggaatcccaacaaat
taccatggggaggttgttaccattaaaggcagtgatcccgatgcagttgttcctgggctt
atggctgctggagaggcagcttgtgcctctgttcacggtgccaatcgtcttggtgctaat
tctcttcttgacattgttgtttttggtcgtgcctgtgcaaatagggttgcagagatccat
agaccaggtgaaacacaaaaaccattgcctaaggatgctggagagaagactattgcatgg
ttagacaagattaggaattcaaatggctcacttcctacctcgaagattaggttgaatatg
cagcgaattatgcaaaacaatgccgctgttttccgcacacaggaaactttagaagaaggt
tgcaatttgattgataaagcatgggagagctaccacgatgttaaattgaaagaccgaacc
ttgatatggaactcggacttgctggagaccatagagttggaaaaccttttgattaatgca
tgtatcaccatgcattcagctgaagctaggaaagagagtagaggagctcatgcccgtgaa
gattttacgaaaagagatgatgagaattggatgaaacacacactaggatactgggagaac
gagaaggtccgactggactacaggccagttcacatgaatactcttgatgacgaggtggag
actttcccgccaaaagctcgtgtgtactaa

DBGET integrated database retrieval system