KEGG   Helianthus annuus (common sunflower): 110878972Help
Entry
110878972         CDS       T05101                                 

Definition
(RefSeq) DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han03030  DNA replication
han03410  Base excision repair
han03420  Nucleotide excision repair
han03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:han00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110878972
   03410 Base excision repair
    110878972
   03420 Nucleotide excision repair
    110878972
   03430 Mismatch repair
    110878972
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:han03032]
    110878972
   03400 DNA repair and recombination proteins [BR:han03400]
    110878972
Enzymes [BR:han01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110878972
    6.5.1.6  DNA ligase (ATP or NAD+)
     110878972
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110878972
DNA replication proteins [BR:han03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110878972
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110878972
DNA repair and recombination proteins [BR:han03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110878972
   NER (nucleotide excision repair)
    Other NER factors
     110878972
   MMR (mismatch excision repair)
    Other MMR factors
     110878972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DRMBL Lactamase_B_2 UBA_4 RMMBL Med14
Motif
Other DBs
NCBI-GeneID: 110878972
NCBI-ProteinID: XP_021983066
LinkDB All DBs
AA seq 1369 aa AA seqDB search
MSSSSSHHSKTLTLDSTTLFLNSPQTTTTPLPPIPTDFPLSKLIPKTKFIIDGFRFSGDH
SISYFLTHFHSDHYTGLNSTWNKGIIYCSPTTARLLIQVLNVSSSFVVSLPLSKPVSIDG
CEVSLIDANHCPGAVQFLFRVPTEEGNWMRYVHTGDFRYCGSMKSDPVLSEFIGADAVFL
DTTYCNPKYVFPSQDESIDYVVNVINKYSVDNGNGNGNGNGVKSVLFLVATYVIGKEKIL
LEISRRCGRKIQVEDRKLGILRTLGFGEDGVFTNEECESDVHVIGWNVLGETWPYFKPNF
VKMKEIMEARGYSKVVGFVPTGWTYEVKRNKFAVRVKDSFEIHLVPYSEHSNYEELREYV
KFLRPKRVIPTVGVDVENVDGKHVNKMLKHFAGLVDEMAIKQDFLMGFHRGPKELNGSLE
KNSHNLKEKVSEPEKEEHGSRDSVLVTDKEMDEMILELHDCLPAWVTRDQMMDLISKSDK
NVVEAASYFFEHETEYHEQVITSTSASASQESSVDILKHVIAHASSTCTPVKTFTKGFAS
SSTPIKTKLKTEGSPSSKRKKPSSTKQSSKNNASPSQKRKTSETKSSKKPIATSQLETSG
PKQCTITKFFNKATPTAEPSQNDDKVLPSIDITHYKDEVDQFIQIVNGSESLRSYATTIL
EETKGDINKALDLYYTNSKDKQSEDTEVSMKDNVDKTCSKQSKESLTPQPPAGNVASDLV
SLPPEKYSPTDHACWKEGQSAPYLHLARTFSLLEDEKGKIKATSMLCNMFRSLLILSPED
VLPAVYLCTNKIAPDHENMELNIGGSVVTAAMEEACGTNRSKIRDLYNSLGDLGDVAQLC
RQTQKLLAPPAPLSIRGVYSVLREISVQTGSGSTMRKRSLIVNLMRSCREMEIKFIVRTL
VRNLRIGAMMRTVLPALAHAIVMNSCQGKTIENLKEMLQGLSAAVIEAYNILPNLDLLIP
SVMDKGIKFSSETLSMVPGIPIKPMLAKITNGVPQVLKLFQGKALTCEFKYDGQRAQVHK
LADGSIRVFSRNGDDTTSRFPDVISILNELCKPETMTFIIDAEVVAIDRKSGPKLLSFQE
LSSRDRGGKNSVIAVDNIKVDICVFAFDVMLANGEQLLGLPLRQRRKYLKDLFGEEKIGY
FEYSKQITVEADNAYVENEATVTKMNLFFEEAFHSSCEGIMVKSLDVEAGYLPSKRSDSW
LKVKRDYVEGLNDSLDLVPIGAWYGNGRKAGWYSPFLMACYDPDTDEYQSVCRVMSGFSD
AFYIEMKEFFIDDKILGKKDKPVYYQTGEEPDMWFTPEVVWEIRGADFTVSPVHHAAMGL
VHPTRGISVRFPRYVRSRSDKKPSDCSTPADIAEMFHLQTRKMDVRGGN
NT seq 4110 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatcctcatcacaccactccaaaaccctaaccctagactccacaaccttattc
ctaaactccccacaaacaaccaccactcctctccctcccatccccaccgacttccccctc
tccaaactcatccccaaaaccaaattcatcatcgacggtttccgcttctccggcgaccac
tccatctcctacttcctcacacacttccactccgatcactacaccggcctcaactccacc
tggaacaaaggcatcatatactgctccccaaccacagctcgccttcttatccaagtcctc
aacgtttcatcttctttcgttgtgtcgttgccgctttccaagccggtttcgatcgatgga
tgtgaggtttcgttgatcgatgcgaatcattgtcctggtgccgttcagtttttgttcaga
gttcccactgaggaggggaattggatgaggtatgtgcataccggtgactttaggtattgc
ggttcgatgaaatcggatcctgtgttgagtgagtttattggcgctgatgctgtgttttta
gatactacttattgtaatccgaaatatgtgtttccgtcgcaagacgagagtattgattat
gttgttaatgtgattaataagtatagtgttgataatgggaatgggaatgggaatgggaat
ggtgtgaagtcggttttgtttcttgttgctacttatgttattgggaaggagaagattttg
cttgagatttcgcgtaggtgtggtaggaagatacaagttgaagaccggaaattggggatt
ctgcgtactctagggtttggggaagatggagtttttactaatgaagagtgtgaaagtgat
gttcatgttattgggtggaatgttttaggggaaacttggccgtattttaaaccgaatttt
gtgaagatgaaggagattatggaggctagaggttactcgaaggtggtgggatttgtacct
acgggttggacgtatgaagtaaagcgtaataagtttgctgtgagggtaaaagattcattt
gagatacatttagtaccttatagtgagcactcgaattacgaagagcttagggagtatgta
aagtttttaagaccaaaacgggttattccaacagttggtgtggatgttgagaatgttgac
gggaagcatgttaacaaaatgctgaagcattttgctggtttggttgacgaaatggccatc
aagcaagacttcttgatgggctttcatcgggggcccaaggaactgaacgggagccttgag
aagaactcgcacaacctaaaggaaaaagtttcggagcccgagaaagaggaacatggttca
cgggattcggtattagtaaccgacaaagaaatggatgaaatgatactggaacttcatgat
tgcttgccagcttgggtcactagggatcaaatgatggatcttataagtaaatcggataaa
aacgttgttgaagcagcctcttattttttcgaacatgaaaccgaatatcatgaacaggtc
attactagtacatctgcttctgcttcacaagaaagctcagttgatatacttaagcacgtc
attgctcatgcttcatccacctgcacacccgttaaaacttttactaaaggctttgcatca
tcttcaactcctattaaaactaaattaaaaaccgagggtagtccttcaagtaaaagaaaa
aaaccatccagcactaaacaatcaagtaagaacaacgcttctcctagccaaaagaggaag
accagtgaaactaagtcaagcaagaagccgatagccacttcacaacttgaaactagtgga
ccgaagcaatgtacaataactaaattcttcaataaggctacacctacggctgaaccgtct
caaaatgatgacaaggtgttaccaagtattgacatcacacattacaaagacgaggtggac
cagtttattcaaatcgtaaatggcagcgagtcattgcgtagctatgctaccactatctta
gaggaaacaaagggtgatattaataaagctctcgacttgtattacaccaactccaaagat
aaacaaagtgaagacactgaagtatctatgaaagataacgttgacaagacctgttccaag
cagtcaaaagagtctttgacacctcaaccgccagctggcaatgttgcttctgatcttgta
tcactaccacctgagaagtattctcccacagaccatgcctgctggaaagagggccagtct
gctccttatctacatctcgccaggacattcagtttgttggaagatgaaaaaggaaagatt
aaagctacatctatgctttgcaatatgtttagaagcttgttaattttgtcgccagaggat
gtactgccagccgtgtacttgtgcacaaacaagattgcacctgaccatgaaaacatggaa
ctaaacattggtggaagtgttgtcacagcagcaatggaagaggcatgtgggacaaacaga
tcaaagattcgggatttgtacaacagcttaggtgatcttggtgatgttgctcaactttgc
cgtcagacacaaaaattacttgcacctccagccccgctttcaattcgaggtgtttattcg
gtgcttcgggagataagtgtgcagacaggtagtggaagtaccatgagaaagagaagcctc
attgttaatctaatgagatcttgtagagagatggagatcaagtttatagtcagaacactg
gttagaaatttaagaatcggggccatgatgagaactgttctgcctgcgttagctcatgca
attgttatgaactcttgccaaggaaaaactatagaaaatctcaaagaaatgcttcagggt
ctctccgcagcagttattgaagcatacaatatcctcccaaatttggatctgctcattcct
tctgttatggataaagggattaaattttcatcggaaacactgtctatggttcctggcata
ccaatcaagccaatgctggcaaaaattactaacggagtccctcaagtgttgaagcttttt
cagggaaaagcacttacctgtgagtttaaatatgatggtcagcgtgcgcaagttcataaa
ttagctgacgggtctatacgtgtgttttcacggaatggggacgacacgacatctagattt
ccagatgtaataagtatattaaatgagctctgcaagcctgagaccatgactttcataatt
gatgccgaggtggttgctatcgatagaaaaagtggtcccaaacttctttcattccaagaa
ctatcttcccgtgatagaggtggcaaaaattcagttattgcagtagataacataaaggtt
gatatatgtgtattcgcttttgatgtcatgcttgctaatggggaacagctgttgggttta
cctttgcgtcaaagaagaaaatatctgaaagatttgtttggtgaagaaaagataggatat
tttgaatattccaagcaaataacagtggaggcggataatgcttacgtggaaaatgaagcc
acagtgactaaaatgaacctgttttttgaagaagctttccattcctcatgtgaaggaatc
atggttaaatctcttgatgttgaagctggttatctcccatcaaagcgttctgattcttgg
ttaaaggtgaagcgagattatgtagaaggtttaaatgattccttggacttggttcctatt
ggtgcttggtacgggaatggaaggaaggctggatggtacagtccatttctcatggcttgc
tatgatcccgacactgatgaatatcaaagtgtctgtcgtgtaatgtccggcttctctgat
gccttctatatagagatgaaagagttcttcatagatgacaagattctaggtaaaaaagat
aaaccagtgtattatcaaacaggtgaggagcctgatatgtggtttacacctgaagtggtg
tgggagatacgaggtgctgatttcactgtttccccggttcaccatgctgcaatgggttta
gtgcatccaacacgtggcatttccgtcagatttcctagatatgttagatctaggtcagat
aagaagccaagtgattgtagtacacctgcagatatagctgaaatgtttcatctgcaaacc
cgaaagatggatgttcgcggtggcaactaa

DBGET integrated database retrieval system