KEGG   Helianthus annuus (common sunflower): 110880155Help
Entry
110880155         CDS       T05101                                 

Definition
(RefSeq) NADP-dependent malic enzyme, chloroplastic-like isoform X1
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00620  Pyruvate metabolism
han00710  Carbon fixation in photosynthetic organisms
han01100  Metabolic pathways
han01200  Carbon metabolism
Module
han_M00169  CAM (Crassulacean acid metabolism), light
han_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    110880155
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110880155
Enzymes [BR:han01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     110880155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-GeneID: 110880155
NCBI-ProteinID: XP_021984422
LinkDB All DBs
AA seq 649 aa AA seqDB search
MSIKGTTFMNNNSVSGVSRMRQSQSLRVSGRYPMVVSMMNRNGRPETSVGVSVDNVVKEV
NGPIMVEVVDRKLKQQSSVVVEGSSDDVYIEDMSTKDEYVTPLSVSVASGYSLLRNPRHN
KGLAFTENERDAHYIRGLLPPGVVKQDLQVKKTMNDLRQYEVPLHKYQAMMALQERNERL
FYKLLVENVEELLPIVYTPTVGEACQKYGSIFKRPQGLFITIEDKGRILEILNNWPEKDI
QVIIVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGIRPSACLPITIDVGTNNEKLLND
EFYIGLRQKRATGQEYAELMNEFMSAVKQNYGEKVLIQFEDFANHNAFDLLAKYSPTHLV
FNDDIQGTASVVLAGLISALKLVGGSLADHRFLFLGAGEAGTGIAELIALEISKQTRAPL
EEARKKIWLVDSKGLIVKSRLNSLQHFKKPWAQEHQPVTDLLDAVKAIRPTVLIGSSGVG
QTFTKEVVETMSSFNKKPIILALSNPTSKSECTAEQAYTWSEGRAIFASGSPFGPVEYNG
KVYVSGQSNNAYTFPGLGLGLIISGAIRVHDDMLLAASEALAAQVTLEHIEKGLIYPPFT
NIRKISAHIAAKVAAKAYELDLASRFPQPENLIAYAESCMYSPNYQKYR
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcaaagggaccacatttatgaataacaactccgtttcgggagtttcaagaatg
aggcaatcacagtcgttgcgagtgtcgggtcgttatcctatggtagtgtctatgatgaac
cgcaatggccgaccggaaacaagcgttggcgtttcggtagacaacgttgttaaggaggtt
aatggtccgatcatggtcgaagttgtcgaccgtaaactaaaacaacagtctagtgttgtt
gtcgaaggtagctctgatgacgtgtacatcgaggatatgtccactaaggatgaatatgtc
actcctttgtctgtttctgttgccagtggttactcactgctgcgtaatccacgccacaac
aaaggtctagcattcacagaaaatgaaagagatgctcattacatacgcggtcttcttcca
cccggtgttgttaaacaagatcttcaggtgaagaagacgatgaatgatctccgccaatat
gaagtacctttgcataagtaccaagccatgatggctcttcaagagagaaatgagaggcta
ttttacaagctgctagttgaaaatgttgaggagctccttccaattgtatacactccaact
gttggtgaagcatgccaaaagtatggtagcattttcaagcggccgcagggtttgtttatc
actatagaagataaggggagaattcttgagattttaaataattggccggagaaggatatt
caagttatcattgtcacagacggtgaacggatcttgggacttggagaccttggttgccag
gggatggggattccagtgggaaagttatctctttatactgcccttggaggaattcgtcct
tcggcttgcttgcctataaccatagatgtgggtacaaacaatgagaaactcttaaatgat
gaattctacattggtctgcgacaaaaaagagcaaccggacaggaatatgcagaacttatg
aatgaatttatgtctgctgtgaagcaaaactatggggagaaggtgcttattcagtttgag
gattttgctaaccacaatgcgtttgatcttcttgcaaagtatagtcccacccaccttgtt
ttcaatgacgacatacaggggacagcgtcggtagtacttgcagggcttatatccgcgcta
aaattagttggtggatccttagctgaccatagattccttttccttggagctggtgaggct
ggcactggcattgctgaacttatagctcttgagatatcaaaacagacgcgggccccactg
gaagaggctcgcaagaagatttggcttgtggattccaaggggttgatagttaaatcccgg
ttaaattcacttcaacatttcaagaaaccatgggcccaagaacaccagcccgttacagat
ctcctagatgccgtcaaggcgatcaggccaactgtgttgattggatcttcaggggtagga
cagacatttactaaagaagtagttgaaactatgtcatcttttaacaagaaaccgattatt
cttgctctttcaaacccgacttcgaaatctgaatgtactgccgaacaagcttatacttgg
agtgagggtcgtgccatattcgctagtgggagcccgtttggcccggttgaatataacggg
aaagtttacgtatctggacagtcaaacaatgcatacactttccctggattgggcctgggc
ttgataatttctggtgcgattcgtgttcatgacgacatgcttttagcagcctctgaagca
cttgctgcacaagtcacactagagcatattgagaaaggactaatataccctccgttcact
aatattcgaaagatttcggctcatattgctgccaaggtggcagccaaagcatatgaactt
gatttggctagtcggtttcctcaaccagaaaacctgatagcttatgctgagagctgcatg
tacagtcctaattatcagaaatatcgctag

DBGET integrated database retrieval system