KEGG   Helianthus annuus (common sunflower): 110886914Help
Entry
110886914         CDS       T05101                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00071  Fatty acid degradation
han00592  alpha-Linolenic acid metabolism
han01100  Metabolic pathways
han01110  Biosynthesis of secondary metabolites
han01212  Fatty acid metabolism
Module
han_M00087  beta-Oxidation
han_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110886914
   00592 alpha-Linolenic acid metabolism
    110886914
Enzymes [BR:han01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     110886914
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     110886914
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     110886914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 110886914
NCBI-ProteinID: XP_021990484
LinkDB All DBs
AA seq 724 aa AA seqDB search
MAEATVTMEVGSDGVALITISNSPVNALALPILAGLKENLAEAMRRDDVKALVLTGKNGR
FSGGFDINVFQKVHRTGDISHLPDVSVELVTNTLEDAKKPIVAAVQGLALGGGLEVAMAC
HARIAAPKTQLGLPELSLGIMPGFGGTQRLPRLLGLSKAIDIMLTSKPILSEEGNKLGLI
DAIAPPQDLLKVSRQWALDIAEARKPWVRSLHRTDKIGSLSEAREIIKKARQSAKRTAPN
MPHHQACLDVIEEGIVRGGYAGVLKEVKVFNELVLSDTAKGLVHVFFAQRAISKVPKVTD
IGLKPRAVKKVAVIGGGLMGSGIATALILGNINVVLKEVNSEYLQKGIKTIEGNVRGLVA
RKRLAQAQAEKALSMIKGVLDYSEFRDVDMVIEAVIENVPLKQKIFSELENVCPPHCILA
TNTSTIDLNLVGEKTKSQDRVIGAHFFSPAHIMPLLEIVRTEKTSAQVILDLMTVGKIIK
KAPVVVGNCTGFAVNRTFFPYTQGAYVLLHLGVDIFRIDRLISSFGLPMGPFQLQDLAGY
GVAVAVGKEFAKAFPDRTFRSPITDLMIKSGRNGKNNGKGYYIYEKGSKPKPDPQVFPIL
EEARRQVNIMPGGKPINITDEEIVEMILFPVVNEACRVLEEGVVVRASDLDVASVLGMSF
PSYRGGIVFWGDLVGAKHIYASLKKWSEKYSDFYKPSRFLEERAKNGVPLSAPLSASTSS
RARL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcaacagtcacgatggaggtgggttccgatggtgttgctctcatcaccatc
tcaaactcccctgttaacgctttagctcttccaattcttgctggattgaaggagaatttg
gcagaggctatgaggagagatgatgtaaaagctctggttttgactggcaagaacggtaga
ttttccggtgggttcgacatcaacgtgttccagaaagttcaccggactggagacatatct
catctacctgacgtatccgttgaacttgtgaccaacacactcgaagatgcgaagaaaccg
atagttgctgctgtgcaaggactcgcactcgggggtgggctagaagttgcaatggcatgt
catgcgcgtatcgcagctccaaagactcaacttggcttgcctgaattgtctcttggaatt
atgcccggctttggaggtacccagagacttccgaggcttttggggttgtcaaaggcaatc
gatataatgttgacatctaaaccgatactatcggaggaagggaacaagctaggtcttatt
gatgctattgcacctcctcaagatttattaaaagtgtctaggcaatgggctttagacata
gcagaggcccgtaaaccttgggtccgctcacttcatcggacggataagatcggttctctt
tccgaagcccgtgagatcataaaaaaagctagacaatcagccaaacggacggcccctaat
atgccacatcatcaagcatgccttgatgtgattgaagaaggtattgttcgtggtggatat
gctggcgttttgaaggaggtcaaggtgtttaacgagctcgttctttccgacacagcgaaa
ggccttgttcatgtattctttgcacaacgtgcaatctcaaaggtacctaaagtaaccgat
atcgggctaaagccacgggctgttaaaaaagttgccgtgattggcggaggtctcatgggg
tcaggaatagctacagccctaattcttggtaacataaacgttgttcttaaggaagtcaac
tctgagtatcttcaaaagggcataaaaacaatagaaggaaatgttcgaggtttggttgcg
aggaagaggttagcacaggcacaagctgaaaaagccttatccatgattaaaggcgtatta
gattactcggaatttagagatgtggatatggttatagaggcggttattgagaatgttcca
ctgaagcaaaagatttttagcgaactcgagaacgtgtgtcccccccattgcattttggca
accaacacatctaccattgatctcaacttagtcggagagaaaacaaaatctcaagatcga
gttataggggcacatttctttagcccggctcatattatgcctctattggagatagtcaga
acagaaaagacttctgcacaagtgattttagatcttatgacagttggaaaaatcattaaa
aaggctccggttgtggtgggaaactgtaccggatttgctgttaaccgcaccttttttccg
tacacacagggtgcatatgtcttgcttcatttaggtgttgatatatttagaatcgacaga
ttgatcagtagctttggactccccatgggcccgttccagcttcaagatttagcgggatac
ggtgtagctgttgctgtcggtaaagaatttgccaaagcttttcctgatcgtacattccgg
tctcctataactgaccttatgattaaaagtggacgaaacggtaaaaataatggaaaagga
tattatatttacgagaagggtagcaagccaaaacccgatccacaagtgttcccgatttta
gaagaggctagaagacaagtcaacattatgcccggaggaaagcctataaacattaccgac
gaagaaatagttgaaatgatattgtttccggtagtgaacgaggcatgccgtgttctagaa
gaaggagttgtggtccgggcatctgatcttgatgttgcatccgttcttggaatgagtttt
ccttcttaccgtggcggtattgtgttctggggagatttagttggggctaaacacatatac
gcaagtctcaagaaatggtctgaaaaatacagcgacttttacaagccatcaagatttctt
gaagaaagagcgaaaaatggtgtcccattgagtgctccattgtcggcgtctacaagctca
agggctcgtctgtag

DBGET integrated database retrieval system