KEGG   Helianthus annuus (common sunflower): 110893760Help
Entry
110893760         CDS       T05101                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00010  Glycolysis / Gluconeogenesis
han00051  Fructose and mannose metabolism
han00052  Galactose metabolism
han00500  Starch and sucrose metabolism
han00520  Amino sugar and nucleotide sugar metabolism
han01100  Metabolic pathways
han01110  Biosynthesis of secondary metabolites
han01200  Carbon metabolism
Module
han_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
han_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110893760
   00051 Fructose and mannose metabolism
    110893760
   00052 Galactose metabolism
    110893760
   00500 Starch and sucrose metabolism
    110893760
   00520 Amino sugar and nucleotide sugar metabolism
    110893760
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110893760
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:han04131]
    110893760
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110893760
Membrane trafficking [BR:han04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110893760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 110893760
NCBI-ProteinID: XP_021996578
LinkDB All DBs
AA seq 498 aa AA seqDB search
MGKVAVAATVVCAAAVTAAAVVVVRHRMKNSGKWAKAMEILKEFEDKCGTPVSKLRQVAD
AMTVEMHAGLASDGGSKLKMLISYVDNLPTGDETGIFYALDLGGTNFRVLRVKLGGVGNV
KKEFKEVSIPPNLMIGKSEDLFDFIAGELAKFVATEDEDMQIPPGTQRELGFTFSFPVKQ
SSIAGGTLVRWTKGFNIEDAVGADVVEELTKAMERAGLDMRVSALVNDTVGTLAGGRYGN
SDVIAAVILGTGTNAAYVERANAIPKWQGLLPKSGEMVINMEWGNFRSSHLPLTEYDEGL
DGDSLNPGEQIYEKLISGMYLGEVVRRVLLKMAEEAELFGDTVPSKLQKPFILRTPDMSA
MHHDSTPDLKVVATKLKDILEISNTSLKTRKVIVEVCDLVATRGARLSAAGILGILKKIG
KDTCKEGEENQKSVIAMDGGLFEHYTKFRKTMQDTMNELLGEEISKNIIVELSNDGSGLG
AALLAASHSQYLEYIEST
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggtagcagtagcggccacggtggtctgcgccgccgctgtgaccgcggcggcg
gtggttgtggtccggcaccggatgaagaactccggcaagtgggcaaaagctatggagatt
ttgaaggagtttgaggacaagtgtggaactccggtttcaaaactccggcaggttgctgac
gccatgacggtggagatgcacgccggacttgcttccgacggtggtagtaaactcaagatg
ttaatcagctatgttgacaatcttcccactggggacgaaacgggaattttctatgccctt
gatcttggtggtacaaactttcgtgttcttcgtgtgaaattaggcggagtaggaaacgtg
aaaaaagaatttaaagaagtttcaatccctccaaatctcatgatcgggaaatctgaggat
ttatttgattttattgcgggagaacttgcaaaatttgtggctactgaggatgaagatatg
caaattccacctggcacgcagcgagaattagggtttaccttttcgtttccggttaaacaa
tcgtcaattgcaggagggactcttgtaagatggacaaaaggcttcaatatcgaagatgca
gttggggcggatgttgtagaagagttgacaaaagcgatggaaagggctggccttgatatg
cgtgtttcggctttggtgaatgatacggttggaacgttagctggagggcgatatggtaat
tccgatgtcattgccgctgtaatattaggtacaggaactaatgcagcgtatgtggagcgt
gcgaatgcaatccctaaatggcaaggtcttcttcctaaatcaggagagatggttataaac
atggaatggggcaacttccggtcatcacatcttcctttgaccgagtatgatgaaggtctt
gatggtgatagcctgaaccctggagagcagatatatgagaaactgatttccggaatgtat
ttgggggaagttgtgagacgagtcttgttaaagatggcggaagaagccgagctttttgga
gatactgtgccatccaaactccaaaagccctttatattaaggacccctgatatgtctgcg
atgcatcatgattccactccggatctcaaagtggttgcaaccaagttgaaagatatcctc
gagatatccaacacttctctaaagacgagaaaagtaattgtggaagtctgtgaccttgtg
gcaactcgtggtgctcgtctctcagcggctggaatcctaggaatcctcaaaaaaattgga
aaagatacttgcaaggaaggagaagaaaaccagaaatcagtaatagcaatggacggcggg
ctgtttgaacactacaccaagttccgaaaaacaatgcaagataccatgaatgaattgtta
ggtgaagaaatttccaaaaacatcattgtcgagctatcgaatgacgggtcgggtctcggt
gcggctcttcttgcagcgtctcactcacagtatctcgaatatatagagtccacataa

DBGET integrated database retrieval system