KEGG   Helianthus annuus (common sunflower): 110898313Help
Entry
110898313         CDS       T05101                                 

Definition
(RefSeq) glutathione S-transferase L3-like isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00480  Glutathione metabolism
han01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110898313
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:han02000]
    110898313
Enzymes [BR:han01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110898313
Transporters [BR:han02000]
 Other Transporters
  Pores ion channels [TC:1]
   110898313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N GST_C_5 GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 110898313
NCBI-ProteinID: XP_022000765
LinkDB All DBs
AA seq 233 aa AA seqDB search
MASVKEVLPPVLDSTSQPPPLFDGTTRLYTNYQCPFAQRVWITRNYKGLQDKIKLVPIDL
ANRPAWYKEKVYPENKVPSLEHNNKIIGESLDLAKYLDAHFDGPALLPNDPAKREFAEEL
FTYTDTFSKTVLSSFKGDVVKEAGVAFDYLESALQKFDGPFFLGEISLVDFVYIPFVERF
QIFIQEVFKYDITSGRPKLAAWIEELNKIDAYTVTKADPEHVIQLYKKRFVDQ
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggctagcgtgaaggaggttcttccgccagtgttggattctacttctcaaccgcctcct
ttgttcgacggaaccactaggttatacacaaactaccaatgtcccttcgcacagcgtgtt
tggatcaccaggaattataagggactacaagacaagattaagcttgttcctatagacctt
gctaatagacccgcatggtacaaggagaaagtttacccagaaaataaggtgccatctctt
gaacacaacaacaaaatcattggagagagtctggatttggcgaaatatctagatgctcac
tttgacgggcctgcattactaccaaatgaccctgccaaacgagagtttgctgaggagtta
ttcacatacactgacacatttagtaaaacagtgttatcatcgtttaaaggagatgttgtg
aaagaagctggtgttgcttttgattacttggaatcagctcttcagaagtttgacggtccg
tttttcctcggagagatcagtttggtggactttgtttatattccttttgtagaaaggttt
caaatattcatacaagaggtattcaaatatgatattacctcaggcaggccaaaattagca
gcatggatagaggaactgaacaaaattgatgcgtacacagtgacaaaagcggaccctgaa
cacgttattcagttgtacaaaaagcgttttgtggatcagtga

DBGET integrated database retrieval system