KEGG   Helianthus annuus (common sunflower): 110904044Help
Entry
110904044         CDS       T05101                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00010  Glycolysis / Gluconeogenesis
han00053  Ascorbate and aldarate metabolism
han00071  Fatty acid degradation
han00280  Valine, leucine and isoleucine degradation
han00310  Lysine degradation
han00330  Arginine and proline metabolism
han00340  Histidine metabolism
han00380  Tryptophan metabolism
han00410  beta-Alanine metabolism
han00561  Glycerolipid metabolism
han00620  Pyruvate metabolism
han00903  Limonene and pinene degradation
han01100  Metabolic pathways
han01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110904044
   00053 Ascorbate and aldarate metabolism
    110904044
   00620 Pyruvate metabolism
    110904044
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110904044
   00561 Glycerolipid metabolism
    110904044
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110904044
   00310 Lysine degradation
    110904044
   00330 Arginine and proline metabolism
    110904044
   00340 Histidine metabolism
    110904044
   00380 Tryptophan metabolism
    110904044
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110904044
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    110904044
Enzymes [BR:han01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110904044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 110904044
NCBI-ProteinID: XP_022005546
LinkDB All DBs
AA seq 536 aa AA seqDB search
MAARRMISSSYAPTLLRSLGTYYSGRGTGISKFSTAAAAAAALEEPITPPVKVELTKLLI
NGQFVDAASGKTFPTLDPRTGQLIANVAEGDIEDVNRAVSAARKAFDEGPWPRMTAYQRS
KILLRFADLVEKHTDEIAALEAWDNGKPYEQAASVEIPLFVRLFRYYAGWADKIHGLTLQ
ADGPHHVQTLHEPIGVAGQIIPWNFPLLMYSWKVGPALACGNTVVLKTAEQTPLSALYVS
KLFHEAGLPPGVLNIVSGFGPSAGAALASHMDVDKLAFTGSTNTGQIVLGLAARSNLKPV
TLELGGKSPFIVCEDANVDEAVDLAHDALFFNQGQCCCAGSRTFVHERVYDEFVEKAKAR
ALKRVVGDPFRKGVEQGPQVDSEQFDKILKYIRSGVDGGATLETGGQRFGSNGYYIQPTV
FSNVQDDMLIATDEIFGPVQTILKFKDINEVIRRANATHFGLAAGVFTQNLDTANTLTRA
LKAGTVWINCFDVFDAAIPFGGYKMSGHGREKGIYSLNNYLQVKAVVTHLKNPAWL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcggagaatgatttcttcttcttacgctccaactctcttgcgatcgctcggc
acctattattctggcagaggaactggtatcagtaagtttagtacagctgctgctgctgct
gcggctttagaggaaccgataactccacccgtcaaggttgaactcaccaaactccttatt
aacggacagtttgtggatgcagcatcaggtaagacttttccaacactcgatccaagaaca
gggcaactgattgccaatgtcgctgaaggggatattgaagatgttaaccgtgcagtgtct
gccgcacgcaaagcattcgatgagggcccatggcctagaatgactgcttatcaaagatct
aaaatactgctgcgatttgctgatttggttgagaagcatactgatgaaatagcagctctt
gaagcttgggacaatgggaaaccgtatgaacaggctgcatcagttgaaataccactgttt
gttcgtctttttcgttattatgctggctgggctgataaaattcacgggctcacgcttcag
gctgatgggcctcatcatgttcagaccctccatgaaccgatcggtgttgcgggccaaatc
attccatggaacttccctcttctaatgtattcttggaaggttgggcctgctttagcatgt
ggcaatacggtggtacttaaaaccgctgaacagacgccattgtctgccctctatgtgtca
aagcttttccatgaggcaggacttcctcctggtgtgttgaatattgtgtccggttttggc
ccaagtgctggtgctgctcttgctagccatatggatgtcgataagcttgctttcactgga
tccactaacacgggtcaaatcgttcttggcctggctgcgagaagcaatttaaaaccagtg
acgttagaacttggtgggaaatcacctttcatcgtgtgtgaggatgccaatgttgatgaa
gctgttgatctggcacatgatgctctgttcttcaatcagggtcaatgttgttgtgccgga
tcacgtacatttgtacatgaacgtgtctacgatgagtttgtagagaaagcaaaggcccgc
gctttaaaacgtgtggttggcgatccctttagaaagggtgttgaacaaggtcctcaggtt
gattctgaacaatttgataagatcttgaagtatataagatctggggttgacggtggtgct
actctagaaaccggaggccaaagatttggctctaatggatattatatccaaccaactgtt
ttctcaaatgttcaggatgacatgctaatagcaacagacgaaatctttggaccagtacag
acaattctgaaattcaaggatatcaatgaggtgattcgaagggcaaatgcaactcatttt
ggactagctgctggtgtttttacacaaaatcttgatactgctaatacattaacccgagca
ttgaaagcaggaaccgtgtggatcaactgttttgatgtatttgatgctgcgattccgttt
ggtggttacaagatgagtgggcatggtagagaaaagggaatttacagtctcaataactac
ctgcaagttaaagcggttgttactcatctcaagaatccagcttggctttag

DBGET integrated database retrieval system