KEGG   Helianthus annuus (common sunflower): 110905079Help
Entry
110905079         CDS       T05101                                 

Definition
(RefSeq) L-idonate 5-dehydrogenase-like isoform X1
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00040  Pentose and glucuronate interconversions
han00051  Fructose and mannose metabolism
han01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110905079
   00051 Fructose and mannose metabolism
    110905079
Enzymes [BR:han01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     110905079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 AlaDh_PNT_C UDPG_MGDP_dh_N Methyltransf_25 Pyr_redox_3 2-Hacid_dh_C FAD_binding_3 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 110905079
NCBI-ProteinID: XP_022006656
LinkDB All DBs
AA seq 361 aa AA seqDB search
MMHTEENEQVEEMMNMAAWLLGIKNLQIQPYHLPPLGPNDVKVQIKALGICGSDVHHFKN
MRVANFIVKKPMVIGHECAGIIKDIGSNVKSLAIGDRVALEPGISCQTCNLCKNGTYNLC
KKMKFFGSPPTNGSLANQVVHHSNLVFKLPDNVSLEEGAMCEPLSVGVHACRRAGVNPDT
KVLIVGAGPIGLVTMLAARAFGAPRVVVADVDQHRLSIAKNLGADGTIQVSTNIQDLGEE
ISKIHKIIGENVDISFDCVGFDKTMSTALTATRAGGKVCLVGLGQSRMTIPLVAAAAREV
DVIGIFRYRNTWPLCIELLRTGKIDVKPLITHRYKFTQEDVEKAFETSAKGGSAIKVMFN
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatgcacacagaagagaatgaacaagtggaagagatgatgaacatggcagcttggctt
cttggaatcaagaacctccaaattcaaccttaccatcttcctcctctagggcctaatgat
gttaaagtccagatcaaagctctaggaatttgtggtagtgatgttcatcacttcaagaac
atgcgggttgcaaatttcatagttaaaaagccaatggtaatcggacatgagtgtgctggt
atcatcaaagatatagggtccaatgtgaagtctctagcaattggtgatcgagtagcattg
gagcccggaatcagttgccagacttgtaatctttgcaaaaatggaacctataacttatgc
aaaaagatgaagtttttcggctctccaccgaccaatggttctcttgcaaatcaggtggtt
catcattcaaatctagtgtttaagttgccggataatgtgagcttggaagaaggggccatg
tgtgagccacttagtgttggtgtccatgcttgtaggcgtgccggtgtcaacccagatact
aaagttttgatcgttggggctggacccataggtcttgtaactatgctagctgcacgtgcg
tttggagccccacgagttgtagttgctgatgtggatcaacaccgattatcgattgcaaag
aaccttggcgcagatgggaccattcaagtctctacaaacatccaggatctaggtgaggag
atatcaaagatacacaaaatcattggtgagaatgtggatattagctttgactgtgttggg
tttgacaaaaccatgtcaacagctttgaccgccactcgggctggcggtaaagtatgcctt
gtgggattgggtcagagtcggatgaccatccctttggttgctgctgctgcaagggaagtt
gatgttattgggatatttagatacaggaacacatggccactctgcattgagcttttgaga
accggtaagattgatgtgaagccgcttataacgcatagatataaattcactcaagaagat
gtcgaaaaggcatttgaaacaagcgctaaaggtggtagcgcgattaaggttatgtttaac
ctttaa

DBGET integrated database retrieval system