KEGG   Helianthus annuus (common sunflower): 110912246Help
Entry
110912246         CDS       T05101                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00020  Citrate cycle (TCA cycle)
han00190  Oxidative phosphorylation
han01100  Metabolic pathways
han01110  Biosynthesis of secondary metabolites
han01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110912246
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110912246
Enzymes [BR:han01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110912246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 110912246
NCBI-ProteinID: XP_022012615
LinkDB All DBs
AA seq 274 aa AA seqDB search
MATSLVRRSLSRVHSSPATKLFISRSHASEPQTTQSTPVAQTTPSLKTFQIYRWNPDSPT
KPELKSYEINLNECGPMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIDGCNGLACL
TKIPANNDTMITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPATDGKEVLQSKKDR
AKLDGMYECILCSCCSTSCPSYWWNPESYLGPAALLHANRWIMDSRDEYTKERLDAVNDE
FKLYRCHTILNCARACPKGLNPGKQIQNIKSLQA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggctaccagtctggtccgtcgatctctttctagggttcactcttcacccgcaacaaaa
ctcttcatctcccgatcacacgcatcggagccccaaaccacccaatccacaccagtagcc
caaacaacaccttctctcaaaacatttcaaatctacagatggaaccccgacagcccgacc
aaaccggagctcaaatcctacgaaatcaacctcaacgagtgcggtccaatggtcctagac
gcacttatcaaaatcaaaaacgaggttgacccaaccttaacgttccgcaggtcctgtcgt
gaggggatctgcgggtcgtgtgcaatgaacattgacgggtgtaacgggctcgcttgtttg
acgaagataccggcgaataatgacacaatgattacgcctttgccacatatgtttgtgatt
aaggatttggttgtggatatgacgaatttttataaccagtataagagtattgagccgtgg
ttgaagcggaagagtcctgcaacggatgggaaggaggttttgcagagtaagaaggatcgg
gcgaagctggatgggatgtatgagtgtattttgtgttcttgttgtagtacttcttgcccc
agttattggtggaaccctgagagttatcttggccctgctgcgcttcttcatgcgaatcgg
tggatcatggacagtcgtgatgaatatacaaaagagcgtctagatgctgtaaatgatgaa
ttcaagttgtatcgctgccatacaatcttgaattgtgctcgtgcctgccctaaggggctg
aaccccgggaagcaaatccagaacatcaagagccttcaggcataa

DBGET integrated database retrieval system