KEGG   Helianthus annuus (common sunflower): 110917732Help
Entry
110917732         CDS       T05101                                 

Definition
(RefSeq) beta-galactosidase 17-like isoform X1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00052  Galactose metabolism
han00511  Other glycan degradation
han00531  Glycosaminoglycan degradation
han00600  Sphingolipid metabolism
han00604  Glycosphingolipid biosynthesis - ganglio series
han01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:han00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    110917732
  Lipid metabolism
   00600 Sphingolipid metabolism
    110917732
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    110917732
   00604 Glycosphingolipid biosynthesis - ganglio series
    110917732
   00511 Other glycan degradation
    110917732
Enzymes [BR:han01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     110917732
Exosome [BR:han04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110917732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 OxoDH_E1alpha_N
Motif
Other DBs
NCBI-GeneID: 110917732
NCBI-ProteinID: XP_022017880
LinkDB All DBs
AA seq 681 aa AA seqDB search
MAKRRNLKKTSTIVIFLLCLLAFTTVFAPLPSTLPNSLKPYKHHHHHHHHQLVTARKFEI
ANDMFWKDSEPFRIIGGDLHYFRTLPQYWEDRLLRAKALGLNAIQTYVPWNLHEPKEGQL
DFDGIADILSFLDLCHKLDLLVMLRPGPYICAEWDFGGFPAWLLTKEPAITLRSSDPRYL
ALVDSWWGVLLPKIAHLLYHKGGPIIMVQIENEFGSYGDDKDYLHHLINLARSHLGDDII
LYTTDGGTTYTLARGTIQGDAVFSAVDFSTGEDPWPIFKIQKLFNAPGKSPPLSAEFYTG
WLTHWGESIAKTDATSTASALENILSKNGSAVLYMAHGGTNFGFYSGANAAEESQYDADL
TSYDYDAPISESGDVDGAKFKALRGVIAKYSATSLPPVPLNNKKTGYGRIQLEKTSALFD
VDLSTKAIESENPISMEAAGQMFGFLLYASEYTAKGKGSTLSIPKVHDRAQVYVTCLSED
KRGKPHYVGTINRWSNKPVNLPNAECSSTTRLLILVENMGRINYGQYLFDSKGILSAVYL
DGKPLLNWKMLPIPLSNLNEAPKNNLSFNNSVSARKTRPGLSIKEPAFYSGNFIVDKVTD
TYMSFNGWGKGVAFVNNFNIGRYWPSFGPQCNLYVPAPVLRPGNNVLVILELERPEPKLV
VNSVDRSDFTCGSNNLKLRQL
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacggcgaaacttgaagaagacgtcaaccatcgtgatatttctcctatgtctt
cttgctttcactaccgttttcgcccctcttccttccactctccccaattccctcaaaccc
tacaaacatcaccaccaccatcatcaccatcaacttgttactgctcgtaaatttgaaatt
gcgaatgacatgttctggaaagacagtgagccttttcgaatcatcggtggggacttgcat
tatttccgtacccttcctcagtattgggaagataggctgttaagagctaaagctttgggt
ttgaatgccattcaaacttatgttccatggaatctgcatgaaccgaaagagggtcaactg
gattttgatggtattgctgatatactttcatttcttgacctatgtcacaagttagatttg
ttggtcatgctacgccccgggccttacatttgtgcagaatgggattttggcggtttccct
gcttggttacttactaaagaaccggccataacactaagatcatctgacccaagatacctt
gctttggttgatagctggtggggagtactacttcctaaaatagctcatcttctttaccac
aaaggaggacctataattatggttcagattgagaatgaatttggttcatacggagacgac
aaggattatttgcatcatctgatcaacttagctcggtcacatctcggggatgatataatt
ttatataccacagatggaggcactacgtatactctcgctagaggaacgatacaaggagat
gctgtattttcagctgtcgacttttcaacgggagaggatccttggcctatatttaaaatt
caaaagttatttaatgcaccaggaaaatcaccacccctttctgcagaattttacactggt
tggcttacccattggggggagagtattgctaaaacggacgcaacttctacagcatctgca
ctggaaaacatcttgtcaaaaaatggctctgctgtgctttatatggctcatggcggaacc
aattttggattttatagtggtgcaaatgctgccgaggaatctcagtacgatgctgatctt
acatcctatgattatgatgctcctattagcgagtctggtgatgtcgatggggctaaattc
aaagcattgcggggggttatagctaagtatagtgcaacttctctccctccggttccttta
aataataagaaaacgggatatggtcgtattcaattagaaaaaacctcagcattatttgac
gttgacttgtcaacaaaagctattgaatctgagaacccaatttcaatggaggctgcgggc
cagatgtttggatttttattatatgcttcggaatacactgctaagggcaaagggagcacg
ttgtctataccaaaggtgcatgatagagcccaagtttatgttacctgcctttctgaagat
aagagaggaaaaccacactatgttggtacaattaatagatggtcaaataagcctgtcaac
ctccctaatgctgaatgctcttccactaccagattgttaattctggttgaaaacatgggt
cgtattaattatggacagtatttgtttgatagcaagggcatattgtctgctgtttactta
gatgggaaacctctgctcaactggaaaatgcttccaattcctctcagcaatttaaatgaa
gccccaaaaaacaatctttctttcaacaattcggtttctgcccgtaaaacccgccctggg
ttgagtataaaagaaccagctttctatagtggaaattttattgttgacaaagtgacagac
acctacatgtccttcaatggttggggtaaaggggtggcatttgttaataacttcaatatc
gggagatactggccgtcttttggaccccagtgtaacctctatgtccctgctccagttctc
cgacccggaaataacgtcttggtgatacttgagttagagagacccgaacctaagttggtg
gtgaattcagttgaccggtcagacttcacttgcggctcgaacaatttgaagctacgacag
ctttaa

DBGET integrated database retrieval system