KEGG   Helianthus annuus (common sunflower): 110917736Help
Entry
110917736         CDS       T05101                                 

Definition
(RefSeq) histone deacetylase 19
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
han  Helianthus annuus (common sunflower)
Brite
Enzymes [BR:han01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110917736
Chromosome and associated proteins [BR:han03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     110917736
   HDAC complexes
    Sin3A-HDAC complex
     110917736
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    110917736
  Chromatin remodeling factors
   NuRD complex
    110917736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 110917736
NCBI-ProteinID: XP_022017885
LinkDB All DBs
AA seq 494 aa AA seqDB search
METGGNSLASGPDGSKRKVYYFYDPEVGNYYYGQGHPMKPHRIRMTHALLAHYGLLQNMH
VVKPVPARDKDLCRFHADDYVSFLRGITPETQQDQLRQLKRFNVGEDCPVFDGLYSFCQT
YAGGSVGGAVKLNHEYCDIAINWAGGLHHAKKCEASGFCYVNDIVLSILELLKVHQRVLY
VDIDIHHGDGVEEAFYTTDRVMTVSFHKFGDYFPGTGDIRDIGYSKGKYYSLNVPLDDGI
DDESYQSLFKPIIGKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVKYMRSFN
VPLLLLGGGGYTIRNVARCWCYETGVALGVELEDKMPQHEYYEYFGPDYTLHVAPSNMEN
KNSRQLLDEIRSKLLDNLSKLQHAPSVQFQERPPDTEFPEADEDQEDDDRRSDDSDDENE
GKSFVGRVKRELHDIEPKDMDDIKEGDHAGAREMDASFAEISLKGSNSGAVPAADVKVEQ
GNSNKPDQPADMNL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccggaggcaattctttagcatctgggccagatggatcaaagagaaaagtgtat
tacttttacgacccagaagtcggaaactactattacgggcaaggtcacccaatgaagcca
cacagaattcgcatgacacacgcactattagctcactacggcttactacaaaacatgcat
gtcgtaaagcctgttcccgctagggacaaagatctatgccgcttccatgctgatgattat
gtttcctttttaaggggtatcactccggaaacacagcaagatcaattgagacagttaaaa
cggttcaacgttggtgaagattgccctgtattcgacggtctgtactccttttgtcagacg
tatgctggtggttctgttggtggggctgttaagctgaaccatgagtattgcgatatcgcg
ataaattgggctggtgggctgcatcatgctaagaaatgcgaggcatctggtttctgttac
gtaaacgatattgtgttgtcgattcttgaacttctgaaagtgcaccagcgtgtgctatac
gtggatatcgacattcatcacggtgatggtgtggaggaagcgttttacacaactgacagg
gtcatgacggtttctttccacaaattcggagattactttccgggtacaggggatataaga
gatatcggatactcaaaaggaaaatattattcactaaatgtccctcttgatgatggcatt
gatgatgaaagttaccagtcgttatttaagccgataatcggcaaagttatggaagttttt
aggcccggtgcggttgtgttacaatgcggtgcagattctttatcgggagatagattaggc
tgctttaatctatcgattaaaggtcatgctgaatgtgtgaagtatatgagatcttttaat
gtgccgttactgttgcttggcggtggaggctatactattcgaaatgttgctcgctgctgg
tgctatgagactggagttgcgcttggggttgagttagaagataaaatgcctcaacatgag
tattatgagtattttggtcctgattatactcttcatgttgctccgagtaatatggaaaat
aagaactcgcgccagttgctggatgaaataagatcaaagctacttgataatctttctaaa
cttcaacatgctccaagtgtgcaattccaagaacgcccacctgatacagaattccctgag
gcagatgaagatcaagaagatgatgatcgaagatccgatgattctgatgatgaaaatgag
ggcaagtcttttgttggacgtgtgaaaagggaacttcatgatatcgagcctaaggacatg
gatgatataaaggaaggtgatcatgctggggctagagagatggatgcatcatttgctgaa
atatccttaaagggttcaaattcaggtgcagtgccagcagcagatgtgaaagtagaacag
gggaactctaacaagccagatcagcctgctgatatgaatctataa

DBGET integrated database retrieval system