KEGG   Helianthus annuus (common sunflower): 110917772Help
Entry
110917772         CDS       T05101                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain 4, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00630  Glyoxylate and dicarboxylate metabolism
han00710  Carbon fixation in photosynthetic organisms
han01100  Metabolic pathways
han01200  Carbon metabolism
Module
han_M00165  Reductive pentose phosphate cycle (Calvin cycle)
han_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
han_M00532  Photorespiration
han_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    110917772
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110917772
Enzymes [BR:han01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     110917772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 110917772
NCBI-ProteinID: XP_022017913
LinkDB All DBs
AA seq 178 aa AA seqDB search
MASLSSPTMATAAVPTQATMVAPFTGLRSTAAFPSTKKAENDFSSLPSNGGRVQCMKVWP
PLGLKKYETLSYLPTLTEAQLAKEVDYLLRNKWVPCLEFELEHGFVYRENHRSPGYYDGR
YWTMWKLPMFGCTDSAQVLKELNECKKEYPSAWIRIIGFDNVRQVQCISFIASKPDGF
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactttcctcacccaccatggccaccgcagccgtcccaactcaagccaccatg
gtggctcccttcaccggacttaggtccactgcggctttccctagcaccaaaaaggctgaa
aacgacttctcttccctccccagcaatggtggaagagtgcaatgcatgaaggtgtggccg
ccactcggattgaagaaatacgagactctttcataccttccaactctaactgaggcccag
ttggctaaggaagtcgactaccttctccgcaacaagtgggttccttgtttggaatttgag
ttggaacacgggtttgtctaccgtgagaaccatagatcgccagggtactatgatggcaga
tactggacaatgtggaagttgcccatgtttgggtgcactgattccgcccaggtgctaaaa
gagctaaacgagtgcaagaaggagtacccaagcgcatggatccgtatcattggatttgac
aacgtccgtcaagtccaatgtatcagtttcatcgcatctaagccagatggattctaa

DBGET integrated database retrieval system