KEGG   Helianthus annuus (common sunflower): 110921103Help
Entry
110921103         CDS       T05101                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K21351  sucrose:sucrose fructosyltransferase [EC:2.4.1.99]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110921103
Enzymes [BR:han01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.99  sucrose:sucrose fructosyltransferase
     110921103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357 DUF2448
Motif
Other DBs
NCBI-GeneID: 110921103
NCBI-ProteinID: XP_022021064
LinkDB All DBs
AA seq 644 aa AA seqDB search
MASSSDLENPNASSALPYSYTPLPDGEQTAEPAVVLHPKKAVAFLVCAFLSVGFLVALIG
NNGPLAPKNLNTNVAPSTVATTAKTTPLSRGVDKGVSEKAFRPLLGADNSFPWSSNMLDW
QRTGFHFQPEKNWMNDPNGPVFYKGWYHLFYQYHPDAPVWGKIVWGHAVSKDLINWRHLP
IAMETDQWYDEQGVWTGSATILPDGQLVVLYTGSTNESVQVQNLAYPADPNDPLLINWVK
YPGNPVLVPPPGIDDKDFRDPTTAWKTPEGKWRITIGSKINKTGISLVYDTEDFKTFELL
DGVLHAVPGTGMWECVDFYPISKQTENGLDTSVDGPGVKHIVKASMDDDRHDYYAIGTYD
AYKGKWTPDNPTLDVGIGLRYDYGIYYASKTFYDQNKNRRVLWSWIKETDTEASDISKGW
ASLMGVPRTILLDKKTKSNIIQWPVEEITALRTDATVFKNLVLEAGALVPLNLPAASQLD
IVAEFELDEATVQRLNGADVAYDCAQSGGAATRGALGPFGLSVLAHDGLVEHTPVYFYVA
KGVDGNLKTFFCADQSRSSTATDVDKSIYGNIVPVLKGEKLSMRILVDHSIVESFAQEGR
TCITSRVYPTKAIYNNARLFLFNNATAATVTASINVWQMKSADI
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcctcagatcttgaaaacccaaatgcctcatctgcccttccttactcctac
accccattgcccgacggcgaacaaaccgccgaacccgccgttgtcctccaccccaaaaag
gcagttgcctttctagtgtgtgcgtttttgtctgtaggttttctagtggcccttatagga
aacaacggaccattagctcctaagaacttaaacacaaatgttgcaccttcaacggtggcc
acaaccgcgaagacgactccattgtctcgtggagtggataaaggtgtgtccgagaaagct
ttccggcctttgttgggtgcggataattcgtttccatggagctctaacatgttggattgg
cagagaactggttttcattttcaacccgagaagaactggatgaatgatcctaacggtcct
gttttctacaaaggatggtaccatttgttttaccaatatcatccggatgctccagtgtgg
ggaaaaattgtttggggtcatgcagtctcgaaagatctaatcaactggcgccaccttcca
atcgcgatggaaaccgaccaatggtacgacgagcagggtgtgtggacaggttcggccacc
atccttccagacggtcaacttgtcgttctctacactggatccaccaacgaatcggtccaa
gttcaaaacctcgcctatccagccgacccaaatgacccacttttaatcaactgggtcaag
taccctggaaacccggtccttgtcccaccacccggtattgatgacaaggacttccgtgac
cccacaactgcgtggaagaccccagagggaaaatggcgaatcactattggttcaaagatc
aacaaaaccggtatctctctggtttacgacaccgaagactttaaaacatttgagctatta
gatggagtgctccatgctgtcccgggcacaggtatgtgggaatgcgttgacttttaccct
atttcgaaacaaaccgaaaatggtcttgatacatccgtagatggaccgggggtcaaacat
atagttaaagcaagcatggatgatgataggcacgactactacgcgattggtacttatgac
gcgtataagggaaaatggacaccggataatcctacattagacgtcgggatcgggttgaga
tacgattacggaatatactatgcctccaagacattttacgaccaaaacaaaaatagaaga
gttttgtggagttggatcaaggagaccgatactgaagcctcggacattagtaagggttgg
gcttctctcatgggtgttccaagaacaattctactagacaaaaaaactaaaagcaacata
atccaatggcctgttgaagaaatcaccgcattgcgaaccgatgcaacagttttcaagaat
ctagtactggaagccggcgcacttgtaccactgaacctgcctgcagcatcccaactagac
attgttgctgagttcgaacttgatgaggcgaccgtgcaacgactaaatggagctgatgtc
gcatacgactgtgcccaaagtggtggggcagcaacacgaggcgctttaggacctttcggt
cttagtgtcctcgcacacgatggcctcgttgagcacactcctgtctatttctacgttgcc
aaaggcgttgatggaaatctaaaaactttcttttgtgcagaccaatcaagatcatccact
gctacagatgtcgataagtcgatctatggaaacattgtccccgtactgaaaggcgaaaaa
ctatcaatgagaattttggtggatcattcgatcgtagaaagctttgcacaagaaggaaga
acatgtattacttcacgagtttatccaacaaaggctatatacaataatgctcggttgttc
ttgttcaacaatgctacagcagcaacagttactgcttcaatcaatgtttggcaaatgaag
tcggccgatatttag

DBGET integrated database retrieval system