KEGG   Helianthus annuus (common sunflower): 110926060Help
Entry
110926060         CDS       T05101                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00052  Galactose metabolism
han00500  Starch and sucrose metabolism
han01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110926060
   00500 Starch and sucrose metabolism
    110926060
Enzymes [BR:han01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110926060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 110926060
NCBI-ProteinID: XP_022025515
LinkDB All DBs
AA seq 884 aa AA seqDB search
MASIAVILLLLLLSSIDQKTVADVVDKQPEPIGYGYSLRSIAFGTNLLVAHLQLNNKSSV
FGPDIDQLRLFASFETGDRLRIRITDAKHQRWEIPTNVLPRQSQPYTLPQQSHNTTPANL
FLSDPNSDLILTLHNTTQFGFTVARRSTADILFDTSGTVLIFKDQYLELTSSLPAHRSSI
YGLGEHTKRTFKLTHNQTLTLWNADIASLNLDVNLYGSHPYYMDVRSPDSNGKVVAGTTH
GVLLLNSNGMDVVYSGDGITYKVIGGVFDFYFFAGPSPELVMDQYTQLIGRPTPMPYWSF
GFHQCRYGYKDVQDLESVVAGYAKAKVPLEVMWTDIDHMDAYKDFTLDPINYPLSKMSPF
VQNLHQNGQKYVLILDPGISVNTTYETYIRGLQADIYIKREGKPYLGEVWPGAVNFPDFL
NPKGAIFWGDEIERFHDILPFDGLWLDMNEQSNFISSPPLPSSKLDNPPYKINNAGYQRL
INERTVPASSLHFGNITAYDAHNLYGFTEARATKDALIKITGKRPFILSRSTFVGSGKFT
AHWTGDNAATWDDLAYSIPSILSSGLFGIPMVGADICGFNGNTTEELCQRWIQLGAFYPF
ARDHSDKATTRQELYLWDSVAATSRKVLGLRYQMLPYLYTLMYNAHTKGTPIARPVFFSF
PQDTNTYDISTQFLIGKSVLVSPVLKPKTVEVDAYFPSGNWFDLFNYSNAVSVGSGTHVR
LHAPADHINVHIREGNILVLQKEALTTKAARVTPFHILVVVSRNENSTGEVYLDDGEETE
VGEVDGKWTFVTFTSQVAGNKATLRSGVQNGGFASSQKWVIEKVTFIGLENGSSKTGYAL
CTSAGAEIRDARVKVSGGGGFGMAEISGLSALIGKEFEVVLDLH
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaatagcggttatattattgttactactgctctcctcgattgatcaaaaaact
gttgcggatgtagtagataagcaacccgaaccgattggttacggctactctcttcgatct
attgcctttggcacaaacttattggtcgctcatcttcaactcaacaacaagtcttctgtc
tttggacccgacatcgatcaactccggctcttcgcaagctttgaaacaggtgatcggtta
aggattcgaatcactgatgcgaaacaccaacgatgggagatcccaaccaacgtgcttcca
cgccaatcacagccttacaccctgccccaacaatctcacaacacaactccagccaacctc
tttctctctgatcctaactctgatctcattctaacactccacaacaccacccaattcgga
ttcacagtcgctcgtcgctctactgccgatatactattcgatacctctggcactgttctc
atcttcaaagaccagtaccttgaactaacatcgtcactcccagctcaccgctcctccata
tacggtttaggagagcacaccaagcgtacgtttaagttaacacataatcagacccttacc
ctttggaatgcggatattgcgagcctgaatctcgatgttaatctatatggatcacatccg
tattatatggatgttagatcaccagattctaatggtaaagtggtggcgggtaccactcat
ggagtgttgttgcttaatagcaatggcatggatgttgtgtatagtggtgatggtattact
tacaaggttattgggggtgtttttgatttttatttctttgctggaccgtcgccggagtta
gttatggatcaatacactcagctcatcggcagaccgactcccatgccttattggtccttc
gggttccatcagtgtcgatacggttacaaagatgttcaggatcttgagagtgttgttgct
ggctatgccaaagccaaggtccctctggaggttatgtggacagatattgaccacatggat
gcttacaaagatttcacactagaccccattaactacccattgtcgaaaatgtcaccattt
gttcaaaatcttcaccaaaacggtcaaaaatatgtgctcatattagatccaggtattagt
gtgaacacaacatatgaaacttacataagaggattacaagctgatatctatataaagcgc
gaaggtaaaccttatttaggtgaggtttggcctggtgctgttaacttcccggatttttta
aatccaaaaggagcaatcttttggggtgatgagatcgaaaggtttcacgatattctacca
tttgatggcctttggcttgacatgaatgaacaatcaaatttcatatcgtcccctccactt
ccatcatcgaaacttgataaccctccatacaagataaacaatgccggttaccaaaggctc
atcaatgagagaactgtgcctgcaagttcattgcattttggcaatattactgcttatgat
gcccataacttgtatggatttactgaagccagggccacaaaggacgcattgataaagata
accggtaaaagaccatttatactttctagatcgacgtttgtggggtctgggaagtttaca
gcacattggaccggggacaacgctgccacatgggatgacttggcgtattccattccgagc
atattgagttccgggttatttggtattccaatggttggtgctgatatatgtggttttaat
ggaaacactactgaagaactttgccagagatggattcagttaggtgccttttatcctttc
gcaagggaccattcagacaaagcaaccacacgacaagaactttatctttgggattcagta
gctgcaacatcacgaaaggtgcttggattgcggtatcaaatgcttccctacttgtacacg
ttaatgtacaatgcacatacaaaggggactccaatcgcacgaccagtgttcttctcattc
ccacaagacaccaacacctatgacataagcactcaattcctcattggcaaaagtgtatta
gtgtcccctgtcttgaagccaaaaacagtcgaggttgacgcttacttcccatctggaaac
tggttcgatctatttaactattccaatgcggttagtgtgggctcagggacccatgttagg
ctccatgcaccagctgaccatataaacgttcatattcgtgaagggaacatattggtttta
caaaaagaagctttgacaacgaaagcagctcgagtgaccccgttccacatactcgttgtg
gttagccgcaacgagaatagcactggtgaggtgtatttggatgatggggaggaaacggag
gttggtgaagtagacggtaagtggacttttgtgacatttactagccaagttgcggggaac
aaagccacgttgagatcaggggtccagaatggcggttttgcatcaagtcagaagtgggta
attgaaaaggtgacatttattgggttggaaaatggttcgagtaaaactggttacgcgcta
tgtacaagcgcgggggcagaaatacgcgacgcaagagtgaaggttagtggtggtgggggg
ttcgggatggcagagatctcgggtttgtctgcgttgattgggaaagagtttgaggtagtg
ttggatcttcactaa

DBGET integrated database retrieval system