KEGG   Helianthus annuus (common sunflower): 110929171Help
Entry
110929171         CDS       T05101                                 

Definition
(RefSeq) aconitate hydratase, cytoplasmic-like
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00020  Citrate cycle (TCA cycle)
han00630  Glyoxylate and dicarboxylate metabolism
han01100  Metabolic pathways
han01110  Biosynthesis of secondary metabolites
han01200  Carbon metabolism
han01210  2-Oxocarboxylic acid metabolism
han01230  Biosynthesis of amino acids
Module
han_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
han_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110929171
   00630 Glyoxylate and dicarboxylate metabolism
    110929171
Enzymes [BR:han01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     110929171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aconitase Aconitase_C HypD
Motif
Other DBs
NCBI-GeneID: 110929171
NCBI-ProteinID: XP_022027985
LinkDB All DBs
AA seq 995 aa AA seqDB search
MPITGPHSSALLRRAFRSSSSSTATRLHSTIARTQPSPIASQCRSYNGVSSAFRNVRSSI
PRWSHGVDWKSPATLTSQIRTAASPVLERFHRTLATMASQNAFSGILTGLPKPGGGEFGK
FYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWEKTAPKQVEIPFKP
ARVLLQDFTGVPAVVDLACMRDAMNNLGGDSDKINPLVPVDLVIDHSVQVDVARSENAVQ
ANMEFEFQRNKERFAFLKWGSKAFHNMLVVPPGSGIVHQVNLEYLGRVVFNTDGVLYPDS
VVGTDSHTTMIDGLGVAGWGVGGIEAEAAMLGQPMSMVLPGVVGFKLSGKLRDGVTATDL
VLTVTQMLRKHGVVGKFVEFHGEGVGKISLADRATIANMSPEYGATMGFFPVDNVTLQYL
RLTGRSDDTVAMIEAYLRANNMFVDYNEPQVERVYSSYLELDLSDVEPCISGPKRPHDRV
PLKEMKADWHSCLDNKVGFKGFAVPKDSQDKVAKFSFHGEPAELRHGSLVIAAITSCTNT
SNPSVMLGAGLVAKKACELGLKVKPWIKTSLAPGSGVVTKYLLKSGLQKYLDEQGFNIVG
YGCTTCIGNSGELDETVGAAISENDIIASAVLSGNRNFEGRVHPLTRANYLASPPLVVAY
ALAGTVDIDFEKEPIGVGKDGKDVYFRDIWPSNQEIADAVQSSVLPDMFKSTYEAITKGN
PMWNNLGVEESKLYSWDSKSTYIHEPPYFKNMTMDPPGAHGVKDAYCLLNFGDSITTDHI
SPAGSIQKDSPAAKYLLERGVDRKDFNSYGSRRGNDEIMARGTFANIRIVNKLLNGEVGP
KTVHIPTGEKLSVFDAASRYKAAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKS
FERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYNIDLPNNINEIRPGQDVTVTTDNG
KSFTCTARFDTEVELAYFNHGGILPYVIRQLTTQK
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgcctataacaggtcctcattcttcagctctcttacgcagagcttttaggtcatcatca
tcttccaccgccaccaggctccactctaccatcgccagaacgcaaccgtctccgatcgcc
tcgcagtgccgatcgtacaacggtgtttcctccgctttccgtaacgttagatcgtctatt
ccacggtggagtcacggtgttgattggaagtctccggcgactcttacgtcgcagatcagg
accgccgcgtctcctgtgcttgagcggtttcaccgaaccctagctactatggcttcccag
aatgctttcagtggaattctaactggtcttcccaagcctggaggcggggagttcggaaag
ttttatagtttgcctgctctgaatgatccaagaatagacaagctgccttattccattagg
attcttctagaatctgcaatccgtaactgtgacaatttccaagttacgaaggaagatgtc
gagaagattattgattgggaaaagactgctccaaagcaagttgagattccattcaagcca
gctcgtgttctcttgcaggattttactggtgttccagctgttgttgaccttgcatgtatg
cgtgatgccatgaataatctaggtggcgactctgacaagattaatcctttggttccagtg
gatcttgtgattgaccattcagttcaagttgatgttgccaggtcagaaaatgcagtacaa
gcaaatatggaatttgaattccaaagaaacaaggagagatttgctttccttaagtgggga
tcaaaagcgtttcataacatgcttgttgttccaccaggatctggtatcgtgcaccaggtt
aatctcgaatacttgggtcgggttgttttcaacactgatggagtgctctatcccgacagt
gttgtgggaactgattcccacactaccatgattgatgggttaggtgttgctggttggggt
gtcggaggaatcgaagctgaggcagcaatgcttgggcagccaatgagtatggttctacct
ggcgttgttggcttcaagttatcaggaaaattgcgtgatggtgtaacagcaactgatttg
gttttaactgtcacccaaatgttaaggaagcatggtgtggttggaaaatttgttgaattc
catggtgagggtgtgggtaaaatatctctggctgacagggcaactatcgccaacatgtca
cctgagtatggtgcaacaatggggttcttcccggttgataatgtcactcttcagtatcta
agattaactggacgaagtgatgatactgttgcaatgatagaagcatatttaagggcaaac
aacatgtttgttgattataatgagccacaagtagaaagagtatactcatcctacttggag
ttggacctttcagacgtggaaccttgtatatccgggccaaagaggcctcatgatcgggtt
cctttgaaagaaatgaaagctgattggcattcttgccttgacaacaaagtgggattcaag
ggatttgctgtaccgaaagattctcaagataaagtcgcgaaattttcatttcatggagag
ccagcagaactcaggcatggcagtctcgtaattgccgcaattacaagctgcacaaataca
tcaaaccctagtgttatgcttggggcaggtcttgttgctaaaaaggcttgcgaattgggc
ctaaaggtcaaaccatggattaaaacaagtcttgctccaggctctggagtagttacaaaa
tacttgctcaaaagtgggttgcagaagtatttggatgagcaagggtttaacatcgtcggt
tatggctgcacaacatgtattggtaattcaggtgaactggatgaaacagttggtgctgca
atatctgaaaacgatataatcgcctctgctgttctctccgggaaccgtaactttgagggg
cgtgttcatcccttgacaagagcaaactatcttgcatcgcctcctttggttgttgcctat
gcacttgcaggcacagttgatattgatttcgagaaggaaccaatcggagttggaaaagat
gggaaggatgtttatttcagggatatctggccaagcaaccaagaaattgctgatgccgtt
caatcaagtgttttacccgacatgtttaagagcacttacgaagctatcactaaaggaaat
cccatgtggaacaacttaggagtcgaagaatccaagctatactcatgggactcaaaatct
acttacattcacgagccaccatatttcaaaaacatgacaatggacccacctggggcccac
ggtgtgaaggacgcctactgcttgctaaactttggtgacagtattacaaccgatcacata
tcacctgcaggaagtattcagaaagacagcccagctgcaaaataccttcttgaacgcggg
gttgaccgcaaagactttaattcttatggtagtcgaagaggtaacgatgaaatcatggct
aggggtacttttgccaatatccgcattgttaataagctcttaaacggagaagttggccca
aagactgttcatattccaactggagagaaattatccgtatttgatgcagcatcgagatac
aaggctgctggtcaggatactattgttttggctggagctgagtacggtagtggcagctct
agagattgggctgccaaaggccctatgttgctgggagttaaagcagtgattgctaaaagc
tttgagaggatccatcgcagtaatctagtgggaatgggtatcattcctctttgtttcaag
gctggtgaagatgcagacacactagggttgactggtcatgaacggtataacattgacctc
ccaaacaatatcaatgaaatccggcctggtcaagatgtcactgtcaccaccgataatgga
aagtcgttcacatgcaccgcccgctttgacacagaggtggaattggcatatttcaaccat
ggtggcattcttccatatgtcattcgacaactgactacacagaaatga

DBGET integrated database retrieval system