KEGG   Helianthus annuus (common sunflower): 110943484Help
Entry
110943484         CDS       T05101                                 

Definition
(RefSeq) glutamate decarboxylase-like isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00250  Alanine, aspartate and glutamate metabolism
han00410  beta-Alanine metabolism
han00430  Taurine and hypotaurine metabolism
han00650  Butanoate metabolism
han01100  Metabolic pathways
han01110  Biosynthesis of secondary metabolites
Module
han_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110943484
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110943484
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110943484
   00430 Taurine and hypotaurine metabolism
    110943484
Enzymes [BR:han01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110943484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 110943484
NCBI-ProteinID: XP_022040925
LinkDB All DBs
AA seq 500 aa AA seqDB search
MVISSTTDDYDQNLHCTFASRYVRTSLPRFKMPDKPIPKDAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMSSLNKNYVDMDEYPVTTELQNRCVNMIARLFHAPIGEDDTAVG
VGTVGSSEAIMLAGLAFKRKWQEKRKSQGKTYHNPNIVTGSNVQVCWEKFARYFEVDLKV
VNLTEDCYVMDPVKAVEMVDENTICVAAILGSTMTGEFEDVKLLNELLTKKNKETGWNTP
IHVDAASGGFVAPFLYPDLEWDFRLPLVRSINVSGHKYGLVYAGVGWVVWRTKEDLPDDL
VFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKDVMKNCNENVMVLKEGLEK
TGRFNIISKDIGVPLLAFSLKDSSSYTVFHISESLRRFGWVIPAYTMPPDVQHVSVLRVV
IREDFSHSLADRLIADIVRVVNEMEAARSTDNTRNANISTIKTRNTHEGEASEHSKREMQ
LGISKFWRRFVHGKKSSSVC
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcagcagtacgaccgacgattacgatcagaatttgcactgtactttcgcttcc
agatatgtccgtacgtctcttccaaggtttaagatgcctgataaacctataccgaaggac
gccgcatatcaaattataaacgacgagttaatgctcgacggtaatccgagactgaatttg
gcatcattcgtgaccacatggatggagcccgagtgtgataagcttattatgtcatcactt
aacaagaactatgttgacatggacgagtacccagtcaccactgaacttcagaatcgttgc
gtaaacatgattgcccgtttgttccatgctcccattggggaagacgatactgctgttggt
gtgggaacggtaggatcatcagaagcgataatgcttgcaggtcttgcctttaaaaggaaa
tggcaagaaaagagaaaatcccaaggaaaaacttaccataaccccaatattgttactgga
tctaacgtgcaggtttgttgggagaagttcgcgaggtactttgaggtcgatttgaaagtg
gtaaatctgacagaagattgttatgtgatggaccctgtgaaagctgttgaaatggtggac
gaaaacacgatttgtgttgctgcaattctcggttctacaatgacaggagagtttgaggac
gtcaagcttcttaacgagcttctaacgaaaaaaaacaaagaaacaggatggaacaccccg
attcatgttgatgctgcaagtggagggtttgttgcaccttttttgtacccggatcttgaa
tgggattttcgtttgccacttgtgaggagcataaatgtgagtggtcacaagtatgggcta
gtgtatgctggtgtcggttgggttgtgtggaggacgaaagaggacttgcctgatgatctc
gtgtttcatataaactatttgggatctgatcaacctacttttacactcaacttctctaaa
gggtcgagccagataattgcacaatactaccagtttatacggcttggcttcgagggttac
aaggatgtcatgaagaactgtaacgaaaatgtaatggtgcttaaagaaggactagaaaag
acggggcggtttaatataatctccaaagacattggggtccctttacttgcgttttctctt
aaagacagttcaagttacaccgtgtttcatatatcagagtctctacggcgattcgggtgg
gtcattcctgcatacactatgccgcctgatgtgcaacatgtatctgttcttcgagttgtg
atacgtgaagatttcagccatagtctcgcagatagacttatagcggatatcgtcagagtg
gttaacgagatggaagctgcacgttccactgacaacacgagaaatgcaaatattagtact
atcaaaacgagaaacacgcacgaaggagaggctagtgaacatagcaagagggaaatgcaa
ctaggaataagcaaattctggaggaggttcgtgcatggtaagaaaagtagcagtgtctgc
tag

DBGET integrated database retrieval system