KEGG   Halothece sp. PCC 7418: PCC7418_2463Help
Entry
PCC7418_2463      CDS       T02379                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
hao  Halothece sp. PCC 7418
Pathway
hao00500  Starch and sucrose metabolism
hao01100  Metabolic pathways
hao01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PCC7418_2463
Enzymes [BR:hao01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     PCC7418_2463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Glycos_transf_1
Motif
Other DBs
NCBI-ProteinID: AFZ44610
UniProt: K9YDX8
LinkDB All DBs
Position
2696072..2698648
Genome map
AA seq 858 aa AA seqDB search
MKPIRTFNVSPSLPPKLEPLKKLAYNIHWDWDIEAKDLFRRLDQQLWESCRHNPVSLLGN
ISQERLAEVAEDEGFLAQMERAEQQLDLYLQERTWFRKNRGQIAQKECYAYFCAEYGLTD
CLPLYSGGLGVLAGDHLKSASDLGLPLVAVGLLYQEGYFSQYLNADGWQQEAYPINDFSN
MPLHLEHNPDGSELRVEVDYPGRTVHARVWRIDVGIVRLYLLDTNIEGNSEYDHNITDRL
YGGDLDMRIHQEMMLGIGGFRALKALGYTPTVFHLNEGHSAFLVLERMRRLIEDDGLTFD
EAKQMVQASQMFTTHTPVSAGFDMFNPDQTMYYVGHYADIFDLSREEFLAMGRENTGDLS
SPFSMAALALRTSSFLNGVSKLHGEVSREMFKGMWKGLPVEEVPITSITNGVHARSVVTK
SKQQLYDRYLGPSWSEKGPENPLWEKVDSIPDEELWRNHERARADMVVMVRDWLGKKLRQ
RGASQAELDKATEVLDPDVLTIGFARRFATYKRATLFLRDIERIKKIIMGNPNRRLQFVI
AGKAHPKDMPGKDLIRQLIHTAREEGIEDYLVFVPDYDTHVARSMVSGCDIWLNTPRRPR
EASGTSGMKAAMNGLPNLSIPDGWWDEADYTATGWAIGQGEMYEDQEYQDEVEANALYDL
LEQEIMPLFYNRDANGVPRGWVKKMKNAIRLNTPQFNTARMLRDYSVYGYFPSSDRYFAM
TENKYANAKAVAQWKKQLFERWYDIRIESIDVSEGTDIVVNETIEVKAVLDLAGLKPDDV
SVELYLGNLNSDGEIVKGTPIPMEYTGESSAAGTIYKGSLVYRSSGLQGLSLRVLPKNQY
MAHPHELGLILWADDCQQ
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaattcgtacctttaacgtttcgccgtccctccccccaaaactagagcccttg
aaaaagctggcttataatattcactgggattgggatatcgaagccaaagacctgtttcga
cggttagatcaacaattatgggagtcctgccgtcataaccctgtctccttactcggaaat
atcagtcaagaacgtctcgcggaagttgccgaagatgaaggctttcttgcccaaatggaa
cgggcggaacaacagttagacctctatctccaagaacgaacctggtttcggaaaaatcgc
ggtcaaattgcacaaaaagagtgctatgcgtatttttgtgctgaatacggtttaaccgac
tgcttacccctttactcgggcggtttgggggttttagcgggtgaccatctcaaatcagcc
agtgacttaggcttacccttggttgcagtcgggttactttatcaagaaggatatttctcc
caatacttaaacgccgatggctggcaacaagaagcctatcccatcaacgatttcagcaat
atgcccttgcacttagaacacaatcccgatggttctgagttgcgggtggaggtggactac
ccaggacgcacggttcacgctcgtgtctggcgcattgatgtggggattgttcgtctctat
ctccttgataccaatattgaagggaactctgaatacgaccataacatcactgatcggttg
tatggtggtgatctcgatatgcggattcaccaagaaatgatgctcggaattgggggtttc
cgcgccttaaaagcccttggttatacccccaccgttttccacctcaatgaaggtcacagc
gcgttcttggtgttagaacggatgcgtcgcttgattgaagatgatggcttgacctttgac
gaagcgaaacaaatggtacaagcaagccaaatgttcaccacccatacccccgtttccgca
gggtttgatatgtttaaccccgatcaaaccatgtactatgtgggacattatgctgatatc
tttgacttatcccgagaagaatttttagccatgggacgggaaaacacaggtgatttatcc
tctcccttcagtatggcagcactcgccctccgcaccagttctttcctcaatggggtgagt
aaactccacggcgaagtctctcgggagatgtttaagggaatgtggaaaggacttcctgtg
gaagaagttcccattacctcgattactaatggtgttcacgctcgcagcgttgttaccaaa
tccaaacaacaactttatgatcgctacttgggcccaagctggtcagaaaaaggacccgaa
aaccccctctgggaaaaagtcgattctatccctgatgaggaattgtggcgtaaccatgaa
cgcgctcgtgcggatatggtcgtcatggtgcgagactggttagggaagaaactccgccaa
cgcggtgcaagtcaagcggagttagataaagcaaccgaagtccttgatcctgatgtctta
accattggttttgcccgtcgttttgccacttataaacgggcgactctctttctgcgggat
attgagcgcattaagaaaattatcatgggtaaccccaatcgccgtttacaatttgtgatt
gccgggaaagctcacccgaaagatatgccagggaaagacttgattcgtcaactgattcat
accgcgcgagaggaagggattgaagattatttagtctttgttcccgattatgatactcat
gtggcgcgatccatggtttcgggctgtgatatttggctcaatacccctcgtcgtcctcgt
gaggcttcagggacttctggcatgaaagcagcaatgaatggactgcctaatctcagtatt
cccgatggctggtgggatgaagccgactacaccgcaacgggttgggcgattggtcaaggc
gaaatgtacgaagaccaagaatatcaagatgaggtggaagccaatgccctctacgacctc
ttggaacaagagattatgcccttgttctataatcgcgatgccaatggtgtccctcgcggt
tgggtgaagaagatgaaaaatgcgattcgtctcaatacgccccagtttaatacggcgcgg
atgttgcgagattatagtgtttatggctatttccccagcagcgatcgttatttcgccatg
accgagaacaaatatgccaatgccaaagccgttgcacaatggaaaaaacaactctttgaa
cggtggtatgacatccgcattgaaagcattgatgtttccgaaggaacagatattgttgtc
aatgaaaccattgaggtgaaagcggttttagacttggcgggcttaaaacccgatgatgtc
agtgtggaactctatctgggcaacctcaacagtgatggcgaaatcgtcaaaggcacaccg
attccgatggaatacacgggtgagtcttctgcagcaggaacaatctataagggctctctg
gtttatcgctccagtggcttacaagggttgtccttgcgagtgctaccgaaaaaccaatac
atggcccatcctcatgagttagggttaatcctttgggctgatgattgtcaacagtaa

DBGET integrated database retrieval system