KEGG   Haloplanus sp. CBA1112: DU484_06835Help
Entry
DU484_06835       CDS       T05557                                 

Definition
(GenBank) pyridoxal phosphate-dependent aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
haq  Haloplanus sp. CBA1112
Pathway
haq00220  Arginine biosynthesis
haq00250  Alanine, aspartate and glutamate metabolism
haq00270  Cysteine and methionine metabolism
haq00330  Arginine and proline metabolism
haq00350  Tyrosine metabolism
haq00360  Phenylalanine metabolism
haq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
haq00401  Novobiocin biosynthesis
haq01100  Metabolic pathways
haq01110  Biosynthesis of secondary metabolites
haq01130  Biosynthesis of antibiotics
haq01210  2-Oxocarboxylic acid metabolism
haq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:haq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DU484_06835
   00270 Cysteine and methionine metabolism
    DU484_06835
   00220 Arginine biosynthesis
    DU484_06835
   00330 Arginine and proline metabolism
    DU484_06835
   00350 Tyrosine metabolism
    DU484_06835
   00360 Phenylalanine metabolism
    DU484_06835
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DU484_06835
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    DU484_06835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:haq01007]
    DU484_06835
Enzymes [BR:haq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     DU484_06835
Amino acid related enzymes [BR:haq01007]
 Aminotransferase (transaminase)
  Class I
   DU484_06835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AXG11765
UniProt: A0A345EHU3
LinkDB All DBs
Position
complement(1137341..1138444)
Genome map
AA seq 367 aa AA seqDB search
MFDIAEEMDEDLVRLEVGIPDFDTPAHVVDAACTAAQDGHTSYTTNAGNPELRDAIADHM
ASDYDVRVTPDEVIVTAGGMEALHLAALCTVSPGEEVVFPTPGFPNYWVQTRMADGVPNP
VPMPAESGFTLDADRLVDAIGPDTALVILCSPNNPTGRTYDADEVRAVVDAAADNDAYVV
ADEVYLGLSYDRAPEGVAAMAGHPENVLTVNSCSKRYAMTGWRVGWLAGTTDIVDQATKI
HESTTSCASSVSQHAALAALTGPQDAAEEMYDAFHTRRDYVVERAATIDGLTCPRPEGAF
YAFLDLDLPGTSLEIAEHLLREYGVVLAPGDGFGEVGSGWVRLSFANSLDRLEEGFDRIE
RAIDDAR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatatcgcggaggagatggacgaggacctcgtgcggctggaagtcggcatcccc
gacttcgacacgcccgctcacgtcgtcgacgccgcctgcacggcggcgcaggacggccac
accagttacaccaccaacgccggcaatccggaactccgcgacgctatcgccgatcacatg
gcgagcgactacgacgtccgggtcacccccgacgaagtgatcgtcaccgcgggcgggatg
gaggcgcttcacctcgccgccctctgtaccgtctcgcccggtgaggaagtcgtcttcccg
acgcccggcttccccaactactgggtccagacccggatggccgacggggttcccaacccg
gttcccatgcccgccgaatcggggttcaccctcgacgccgaccgcctcgtcgacgccatc
ggtcccgacaccgccctcgtgattctctgttcgcccaacaaccccaccgggcgcacctac
gacgccgacgaggtccgcgccgtcgtcgacgccgccgccgacaacgacgcctacgtcgtc
gccgacgaggtgtacctcggactcagctacgaccgagcgcccgagggcgtcgccgccatg
gcgggacacccggagaacgtcctcacggtcaactcctgttcgaaacgctacgccatgacc
gggtggcgcgtcggatggctcgcgggaacgaccgacatcgtcgatcaggcgaccaagatc
cacgagtcgaccacctcctgtgcgtcgagcgtgagccagcacgccgccctcgcggcgctg
accggaccacaggatgccgccgaggagatgtacgacgccttccacacgcgccgcgactac
gtggtcgaacgcgccgcgaccatcgacggcctgacctgcccccggccggagggtgccttc
tacgccttcctcgacctcgacctccccgggacgagcctcgagattgccgaacacctcctc
cgggagtacggcgtcgtcctcgcgccgggtgacggcttcggcgaggtcggatcgggctgg
gttcgcctgagcttcgccaacagcctcgaccgtctcgaagagggcttcgaccggatcgaa
cgcgccatcgacgacgcacggtag

DBGET integrated database retrieval system