KEGG   Herminiimonas arsenicoxydans: HEAR0028Help
Entry
HEAR0028          CDS       T00490                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F (Alkyl hydroperoxide reductase F52A protein)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
har  Herminiimonas arsenicoxydans
Brite
KEGG Orthology (KO) [BR:har00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HEAR0028 (ahpF)
Enzymes [BR:har01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HEAR0028 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like Glutaredoxin FAD_binding_3 Thi4 DAO K_oxygenase NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: CAL60264
UniProt: A4G177
LinkDB All DBs
Position
complement(24394..25989)
Genome map
AA seq 531 aa AA seqDB search
MLDANLKTQLAAYLEKIVQPIEIVASLDGSDKSRELQELLQEIVVLTDKITLVERTDDDE
RKPSFIIKRPDAHAGIQFAAIPLGHEFTSLVLALLQTGGHPLKLEDSVIEQIRNLDGDYT
FETYMSLSCHNCPEVVQAFNVMALINPRIRAVTIDGGLFQDEVKERDIMAVPTTFLNGQP
FESGRVSIEQILAKLDTGGNKRKQEELSAKAPYDVLIVGGGPAGAAAAIYAARKGIRTGV
VAERFGGQVLDTLSIENFVSVQETDGPKFAVALEQHVRSYDVDIMNVQQASELVPGKLIE
IKLKDGGSLKGKTVILATGARWRTIDVPGENEYRNKGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVGHVTLIEFGAELRADAVLQRKLRSMPNVTVITSAQTTEITGDGKRV
NGLVYKDRKTEEVKTVELEGVFIQIGLVPNTEWLKGTVALSRHGEIEVDARGQTSVPGVF
AAGDVTTVPYKQIVIAVGEGSKAALSAFDHLIRTPDTDEEVVAIQGEAIPA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatctcaaaacccaattagccgcttatttggaaaagatcgtacaaccg
atcgagatcgtcgcgtcactcgatggcagcgacaaatctcgcgaattgcaggaactgctg
caggaaatcgttgtgctgaccgacaagatcacgctggtcgagcgcaccgatgacgacgag
cgcaaaccttcttttatcatcaagcgcccggacgcacacgcaggcatacagttcgccgcg
attccactgggccacgaattcacttcactggtgctggccttgctgcaaaccggcggccat
ccattgaaactggaagattccgtgatcgaacagatccgcaatctcgatggcgactatacg
tttgaaacctatatgtcgctgtcttgccataactgtccggaagtcgtgcaagccttcaac
gtgatggcgctgatcaatccgcgcatccgtgccgtcacgatcgacggcggcctgttccag
gacgaagtcaaggaacgcgacatcatggccgtgccgacgactttcctgaacggacagccg
tttgaatccggtcgcgtcagcatcgaacagatactcgccaaactcgacaccggcggcaac
aagcgcaagcaggaagaactcagcgcaaaagcgccgtacgacgtactgatcgtcggtggc
gggcctgcgggcgcagcagccgccatctacgccgcacgcaaaggcatacgcaccggcgta
gttgcggagcgtttcggcggtcaggtgctggacactctgtcaattgaaaacttcgtatcg
gtacaggaaaccgacggcccgaaatttgccgtcgcactggaacagcacgtacgcagctat
gacgttgacatcatgaacgtgcagcaggcttccgagctggtgccgggcaagctgatcgaa
atcaagctgaaagacggcggctcgctgaaaggcaaaaccgtcattctggcgacaggtgca
cgctggagaaccatcgacgtgccgggtgaaaacgaataccgcaacaagggtgtcgcgtat
tgtccgcactgtgacggcccgctgttcaaaggcaaacgtgttgccgtgatcggcggcggc
aactccggtgtcgaagcagcgatcgatctggccggcatcgtcggccatgtgaccctgatc
gagtttggtgcagagttgcgtgccgatgcagtgttgcagcgcaagttgcgcagcatgccc
aacgtcaccgtgatcacgtcggcacaaacgactgaaatcaccggcgatggcaaacgcgtc
aacggcttggtctacaaggaccgcaagaccgaagaagtgaagacggtcgaactggagggc
gtcttcatccagatcggtctggtgcctaacaccgaatggctgaaaggcacggtcgccttg
tcgcgtcacggtgagatcgaagtcgatgcccgtggccagacttcagtgccaggcgtattt
gcagccggcgacgtcacgactgtgccgtacaagcagatcgtgattgcggttggcgaaggc
tcgaaagcagcgttgagtgcattcgatcacctgatccgcacgccggatacggatgaagaa
gtagttgcaatccaaggcgaagcaattcctgcctaa

DBGET integrated database retrieval system