KEGG   Herminiimonas arsenicoxydans: HEAR0634Help
Entry
HEAR0634          CDS       T00490                                 

Definition
(GenBank) putative Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:har00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HEAR0634
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:har01002]
    HEAR0634
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:har01011]
    HEAR0634
Enzymes [BR:har01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     HEAR0634
   3.4.21  Serine endopeptidases
    3.4.21.-  
     HEAR0634
Peptidases [BR:har01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   HEAR0634
Peptidoglycan biosynthesis and degradation proteins [BR:har01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   HEAR0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: CAL60832
UniProt: A4G2U5
LinkDB All DBs
Position
636044..637468
Genome map
AA seq 474 aa AA seqDB search
MRIVQQLFFAISLFFPIASCFSCVHAAGLPLPVTDALKRSGIPLNAVGAYVQDVSGPVPR
IAVNSMVGFNPASTMKLVTSNAALDLLGPAFTWKTQVYATGTQSGDVLNGDLVIKGSGDP
KLVTEKFWQLLRQIRAAGIREIRGNLILDRSAFDGMSYDAAQFDGDPLKPYNVGPDALLL
NYKVFAFHFLPDPARHLVDVSVDPPLAGYPITPPVLLDGACADWQAKSLPTLNRKGASFA
GSFAAACGEKTWYLHPYQMSATEYFNVVFRQLWTDVGGVFKGEVNDGVLPSGARMLTEWQ
SPALPEVVRDINKYSNNVMARQLLLTLASDVLKLPATPERGGRVVKTWLAAKGIDTSQLV
IENGSGLSRIERISAEALGRMLVAAFQSPVMPELMSALPLAGYDGTMRKRLLAQTVAGRA
HIKTGSLNDVRAVAGYVLAASGKRYAVVCIINHINAPGGQAAHDALLQWVYENG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgtccaacagctcttttttgccatttccctgtttttccccatcgcttcctgc
ttctcttgtgtccacgctgcaggattgcccttgcctgttaccgatgccttgaagcgcagc
gggattccgctcaatgcggtgggcgcctatgtgcaagatgtttcggggccggttccgcgc
attgctgtcaacagtatggtcggcttcaatccggcttccacgatgaaactggtgaccagc
aatgccgcgctcgatttgctgggcccggcttttacctggaaaacccaggtctatgccacc
ggaacacaaagtggtgatgtgttgaatggcgacctggtgatcaagggcagcggcgacccc
aaactggtgacggaaaaattctggcaattgctgcgccagattcgcgctgccggaatacgc
gaaattcgcggcaatctgattctggatcgcagtgcttttgacggcatgtcctacgatgcc
gcgcaattcgatggtgatccactgaagccatataacgtcgggccggatgcattgctgctg
aattacaaggtattcgcctttcattttctgccggatccggcgcgtcatctggtggatgtc
agcgtcgatccgccgctggccggctatccgattacgccacccgtattgctggatggcgcc
tgtgccgactggcaggcaaaatcgctgccgacactgaatcgcaagggcgccagtttcgcc
ggttcatttgccgcggcatgcggcgagaaaacctggtatctgcacccttaccagatgagc
gcaacagagtatttcaatgtcgtattccgtcaattgtggacagatgtcggtggtgtattc
aagggcgaggtcaacgatggcgtattgccgtccggcgcaagaatgctgacggagtggcaa
tcgccggcattgccggaagttgtgcgcgacatcaacaagtacagcaataatgtcatggcg
cgacaattgctgttgacgctggcgtcggatgttctcaagttgccggcgaccccggagcgg
ggcgggcgggtcgtcaaaacctggctggcggccaaaggtatcgataccagccagttggtg
attgaaaatggctcgggattgtcgcgcatcgaacgtatctcggcagaagccctgggacgc
atgctggtcgcggcctttcaatcgccggtcatgccggagctgatgtccgcattgccgctg
gctggttacgatggcacgatgcgcaagcgcctgctagcgcaaaccgttgccgggcgtgcg
catatcaaaaccggttcattgaatgatgtgcgtgcggtggcgggctatgtactggcggct
tcgggcaaacgttatgcagtcgtctgcatcatcaaccacatcaatgcgcctggcggacaa
gctgcgcatgacgccttgctgcaatgggtatatgaaaatggttga

DBGET integrated database retrieval system