KEGG   Herminiimonas arsenicoxydans: HEAR0840Help
Entry
HEAR0840          CDS       T00490                                 

Gene name
SodC
Definition
(GenBank) Superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
har  Herminiimonas arsenicoxydans
Brite
Enzymes [BR:har01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HEAR0840 (SodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CAL61028
UniProt: A4G3E1
LinkDB All DBs
Position
843625..844155
Genome map
AA seq 176 aa AA seqDB search
MKTVTASALLSAIVLVAGCAGYHATGPSAEARLKPTQGNRTSGFVHFQQNGDRVTVRASI
EGLTPGLHGFHVHEKGDCSAPDAMSAGGHFNPGAKHHGAPTSADHHGGDFGNLTADANGR
ASLTLVVTKGEITLDRDAANSIIGKGLIVHADPDDYKTQPTGNSGKRLACGVIVRN
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgtcacagcatctgcgttattgagcgccattgttctcgttgccggttgcgcc
ggctatcacgctacaggcccgagtgctgaagccagactgaagccgacacagggaaacagg
accagcggcttcgtgcactttcagcaaaacggtgatcgcgtgactgtgcgcgccagcata
gagggtttgacgcccggcctgcacggatttcatgttcatgaaaaaggtgattgcagcgcg
ccggatgccatgagcgccggcgggcattttaatcctggtgcgaaacatcatggcgcaccg
acgagtgccgatcatcatggcggcgactttggtaatctgactgcggatgccaacggcaga
gcatcgctgactctggttgttaccaagggcgagattacgctggatagggatgccgccaac
agcatcatcggcaaaggcttgatcgtgcatgccgatcccgatgattacaaaacccagcct
accggcaattccggcaagcgcctggcttgtggagtgattgtgcgaaactag

DBGET integrated database retrieval system