KEGG   Herminiimonas arsenicoxydans: HEAR1727Help
Entry
HEAR1727          CDS       T00490                                 

Definition
(GenBank) ATP-dependent DNA ligase precursor
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har03030  DNA replication
har03410  Base excision repair
har03420  Nucleotide excision repair
har03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:har00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    HEAR1727
   03410 Base excision repair
    HEAR1727
   03420 Nucleotide excision repair
    HEAR1727
   03430 Mismatch repair
    HEAR1727
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:har03032]
    HEAR1727
   03400 DNA repair and recombination proteins [BR:har03400]
    HEAR1727
Enzymes [BR:har01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     HEAR1727
    6.5.1.6  DNA ligase (ATP or NAD+)
     HEAR1727
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     HEAR1727
DNA replication proteins [BR:har03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    HEAR1727
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     HEAR1727
DNA repair and recombination proteins [BR:har03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     HEAR1727
   NER (nucleotide excision repair)
    Other NER factors
     HEAR1727
   MMR (mismatch exicision repair)
    Other MMR factors
     HEAR1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: CAL61884
UniProt: A4G5U7
LinkDB All DBs
Position
complement(1732486..1733379)
Genome map
AA seq 297 aa AA seqDB search
MTQLLGMLARVSVGLMLAAFLGMAPSSASTEDGTSGARPLMLANSYHSNVDLSAYWVSEK
YDGIRAYWDGEQFFTRGGERIHAPAWFTAGWPQLALDGELWVGRGRFAEAVSTARRQKPE
DDAWRKMHFMVFDLPLHGGVFDERLPALQTVIAKLDVPWVQAVRQIRVHDEHSLRTLLQK
TVQAGGEGLMLHRGASLYRAVRNDDLLKLKLHEDAEARVIAHLPGKGKHQGRLGALLVEM
PDGQRFRLGTGFSDAQRTSPPVIGSWVTYRYRDKNRSGIPRFASFMRVREDIILPSR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacacaactgttggggatgctggcaagagtttcagtcggtctgatgcttgccgcgttc
ctgggcatggcgccatccagcgcatctactgaagatggaacatccggcgctaggccgctg
atgctggcaaacagctatcacagcaatgttgatttatccgcctactgggtcagcgaaaaa
tacgatggcatccgtgcctattgggatggagaacaattcttcacgcgcggcggcgaacgc
attcatgcacctgcatggtttactgcaggctggccgcagctcgcactggatggcgaactg
tgggtcgggcgagggcgttttgccgaggctgtatcgactgcgcgacgacaaaaaccggag
gacgacgcttggcgcaagatgcatttcatggtgttcgatctgccactgcatggcggcgtc
ttcgacgaacgcctgccggcattgcaaaccgtcattgccaaactcgatgtgccctgggtg
caggccgtccggcaaatcagggtgcacgatgaacactccttgcggactctgctgcaaaaa
accgtgcaagccggcggcgaaggattgatgctgcatcgtggggcatccttgtatcgggcc
gtgcgcaacgatgatctgctgaagttgaaactgcatgaagatgctgaagccagagtaatt
gcacacctgccgggcaagggcaagcatcaggggcggctcggcgccttgctggtggaaatg
ccggacggccagcgtttccggctgggtacgggtttcagcgatgcacaacgcacgtcgccg
ccggtaatcggcagttgggtgacgtatcgctatcgggataaaaaccgcagcggcattcca
cgcttcgccagtttcatgcgggtgcgggaagatataatcctgccatccagataa

DBGET integrated database retrieval system