KEGG   Herminiimonas arsenicoxydans: HEAR1772Help
Entry
HEAR1772          CDS       T00490                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component (Alpha-ketoglutarate dehydrogenase)
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00020  Citrate cycle (TCA cycle)
har00310  Lysine degradation
har00380  Tryptophan metabolism
har01100  Metabolic pathways
har01110  Biosynthesis of secondary metabolites
har01120  Microbial metabolism in diverse environments
har01130  Biosynthesis of antibiotics
har01200  Carbon metabolism
Module
har_M00009  Citrate cycle (TCA cycle, Krebs cycle)
har_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HEAR1772 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    HEAR1772 (sucA)
   00380 Tryptophan metabolism
    HEAR1772 (sucA)
Enzymes [BR:har01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     HEAR1772 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: CAL61928
UniProt: A4G5Z1
LinkDB All DBs
Position
complement(1782621..1785479)
Genome map
AA seq 952 aa AA seqDB search
MMQQLLANSYLFGGNAPYVEELYEAYLDNPGSVPDNWRAYFDAMQHVPAVDGSSKPDVAH
ASVIASFAERAKHGPIRNVVASEDVEMGRKRVAVTQLIAAYRVLGNNWANLDPLQRQERR
SIPQLEPAFYGFTDADMDIVFNISNTYFGTETASLRDLLHALRDTYCRSIGPEFMYISDP
AQKLWLQERFESIRSTPTFSSEKKKHILERLSAAEGLERYLHTKYVGQKRFSLEGSESFI
AALDEVIQRGGEKGVQEIVIGMAHRGRLNVLVNTLGKMPQELFAEFEGRHGDDLPSGDVK
YHQGFSSDISTPGGPVHLSLAFNPSHLEIVNPVVEGSVRARIERRGQNDPSQQVLPILIH
GDAAFAGQGVIMETLNLAQTRGYGTGGTVHIIINNQIGFTTSDPRDTRSTLYCTDVAKMI
EAPVIHVNGDDPEAVVFAAQIALDYRLEFRKDIVVDIVCYRKLGHNEQDTPALTQPLMYK
KISQHPGTRKLYADKLFAQGTVAENEADDMVKAYRDAMDAGKHTIDPVISNFKSKYAVDW
LPFLNRKWTDAADTAVPLTELKRLAERVTVIPENFKVHPLVEKVLADRASMGRGEMNLDW
GMGEHLAYASLVASGYAVRLTGQDAGRGTFVHRHAVLHDQNRERWDAGSYVPLQNISDQQ
AWFRVIDSVLSEEAVLAYEYGYSTAEPNTLVIWEAQFGDFANGAQVVIDQFISSGEVKWG
RVSGLVMMLPHGYEGQGPEHSSARPERFLQLCADNNMQVVQPTTAAQIFHLLRRQMIRKF
RKPLVILTPKSLLRNKEAGSPLTDLASGSFQTVIGEVDTSIDAKKVKRVIACSGRVYYDL
VHARKERAQNDVAIVRIEQLYPFPHKAFAAELKKFPNFTDLVWAQDEPQNQGAWFQIQHN
ILENMSDGQKLAYAGRPASASPAVGYYDKHYAQQKTLIETAFSKLKGFIQTK
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcaacttttagccaactcctatctgtttgggggtaatgctccgtacgtggaa
gaactgtacgaagcatatttggataatcccggctccgtgccggataactggcgtgcgtat
ttcgacgccatgcagcacgtgcctgcggttgacggttccagcaagccggacgtggcccat
gcttccgtgatcgcatcttttgcagaacgtgccaaacatggcccgatccgcaatgtggtt
gcctccgaagatgtggaaatggggcgcaaacgcgtcgccgttacacagctgatcgcggct
tatcgcgtacttggcaacaactgggccaatctcgatcccctgcagcgccaggaacgccga
tccattccgcaactggagcctgctttctacggctttaccgatgccgatatggacatcgtg
ttcaacatcagcaatacctatttcggtaccgaaacggcgtcgctgcgcgatttgctgcac
gccttgcgcgacacctattgccgctcgatcggaccggagttcatgtacatcagcgatcct
gcgcagaagctctggctgcaggaacgttttgagtcgatacgttcgacgccgacattttcc
agcgaaaaaaagaagcacattctggagcgcctgagtgcagccgaagggctggagcgttac
ctgcataccaaatacgtggggcaaaaacgcttttcactggaaggcagtgaaagctttatt
gccgcactcgatgaagtgatccagcgcggcggtgaaaagggcgtacaggaaatcgttatc
ggcatggcccatcgcgggcgcctgaatgtgctggtcaatacactgggcaagatgccgcag
gaattgtttgctgaattcgaaggccgccatggcgacgatttgccgtctggcgacgtcaag
tatcaccaaggattttcctccgacatcagcaccccgggtggtccggtgcatctgtcgctg
gctttcaacccatcgcatctggaaatcgtcaatccggtggtggaaggttcggtgcgtgca
cgtatcgaacgtcgcggacaaaacgatccttcgcaacaagtgctgcctatcctgattcac
ggcgacgcagcgtttgccggacagggcgtcatcatggaaaccctgaatctggcgcaaacg
cgcggttacggtaccggtggtacggtacacatcatcatcaacaaccagatcggctttacc
acgtccgatccgcgcgatacgcgttcaacgctgtactgtaccgacgtggccaagatgatt
gaagcgccggtgatccacgtcaacggtgacgatccggaagcggtggtttttgccgcacag
atcgcgctggattatcgtctggaattccgcaaggacatcgtggtcgatatcgtctgctat
cgcaaactgggacataacgaacaggatacgccggcgctgacgcagccgctgatgtacaag
aaaatttcccagcaccccggtacgcgcaagctgtacgccgacaaactgttcgcacaggga
acggtggcggagaatgaagccgatgacatggtcaaggcatatcgcgatgcgatggatgcc
ggcaagcatacgatcgatccggtcatttcgaatttcaaaagcaagtatgcagtggattgg
ctgccgttcctgaatcgcaaatggaccgatgctgccgatacggccgttccgttgacagaa
ttgaagcgcttggctgagcgcgtgactgtgatcccggaaaatttcaaggtgcatccgctg
gtagaaaaagtgctggccgatcgcgccagcatgggacgcggcgaaatgaatctggactgg
ggcatgggtgaacatctggcttatgcatcgctggttgcttccggctatgccgtgcgtctg
accggacaggatgccgggcgcggtactttcgtccatcgtcatgcggtattgcacgatcag
aatcgtgagcgctgggatgccggcagttatgtgcctttgcagaacatctccgaccagcag
gcttggttccgcgtcatcgattctgtactgtcggaagaagcggtgctggcttacgagtac
ggctattcgacggcagagccgaatacgctggtgatctgggaagcgcagttcggcgatttc
gccaatggcgcgcaagtcgtgattgatcagttcatcagctcgggtgaagtgaagtggggg
cgtgtatccggtctggtaatgatgctgccgcatggttacgaaggccagggcccggaacat
tcatcggcccgtcccgagcgtttcctgcaactgtgcgcagacaacaatatgcaagtggta
cagccgactacggcagcgcagattttccatctgctgcgtcgccagatgatccgcaagttc
cgcaaaccgctggtcatcctgactccgaaatcgctgctgcgcaacaaggaagccggttcg
ccgctgaccgatcttgccagcggttcgttccagaccgtgataggcgaagtcgataccagt
atcgacgctaaaaaagtcaaacgcgtcatcgcctgttcggggcgcgtttattacgatctg
gtccatgcgcgcaaggaacgggcacagaacgatgtggccatcgtgcgtatcgaacaactg
tatccattcccgcacaaggcatttgcggcagagctcaagaaatttccgaatttcacggat
ctggtgtgggcgcaggatgaaccgcaaaatcagggtgcatggttccagattcagcacaat
attctggaaaacatgtcggatggacagaagctggcgtatgccggtcgtccagccagcgct
tcacctgccgtcggctactatgacaagcattacgcgcaacagaagacgttgatagaaaca
gcattcagcaagttaaaaggttttatccaaacgaaataa

DBGET integrated database retrieval system