KEGG   Herminiimonas arsenicoxydans: HEAR3168Help
Entry
HEAR3168          CDS       T00490                                 

Gene name
tufB1
Definition
(GenBank) Elongation factor Tu-B (EF-Tu-B)
  KO
K02358  elongation factor Tu
Organism
har  Herminiimonas arsenicoxydans
Brite
KEGG Orthology (KO) [BR:har00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:har03012]
    HEAR3168 (tufB1)
   03029 Mitochondrial biogenesis [BR:har03029]
    HEAR3168 (tufB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:har04147]
    HEAR3168 (tufB1)
Translation factors [BR:har03012]
 Eukaryotic Type
  Elongation factors
   HEAR3168 (tufB1)
 Prokaryotic Type
   HEAR3168 (tufB1)
Mitochondrial biogenesis [BR:har03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HEAR3168 (tufB1)
Exosome [BR:har04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HEAR3168 (tufB1)
  Exosomal proteins of breast cancer cells
   HEAR3168 (tufB1)
  Exosomal proteins of colorectal cancer cells
   HEAR3168 (tufB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: CAL63277
UniProt: A4G9U0
LinkDB All DBs
Position
complement(3119135..3120325)
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKKFGGEAKGYDQIDNAPEEKARG
ITINTSHVEYETTTRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYEFPGDDLPIIKGSAKLALE
GDQGPLGEAAILALADALDSYIPTPERAVDGAFLLPVEDVFSISGRGTVVTGRIERGIVK
VGESLEIVGIRDTQVTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVLAKPGS
IKPHKHFTGEIYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVMLINPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaattcgagcggaccaagccgcacgttaacgtcggtacaattggtcac
gtcgatcacggcaaaaccacactgacggcagcgattgcgaccgtattgtctaagaaattt
ggtggcgaagccaagggctacgaccaaatcgataacgcgcctgaagaaaaagcgcgcggc
atcaccatcaacacctcgcacgttgaatacgaaaccaccacccgtcactatgcccacgtt
gactgcccaggccacgccgactatgttaaaaacatgatcaccggcgccgcacagatggac
ggcgcgatcctggtttgttccgcagctgacggcccaatgccgcaaacacgtgagcacatc
ctgctggcacgtcaggttggcgttccatacatcatcgtgttcctgaacaagtgcgacatg
gttgacgatgcagaattgctcgaactggtcgaaatggaagtgcgcgagctcctctccaaa
tacgaattcccaggcgacgacctgcctatcatcaaaggttcggccaagttggcactcgaa
ggcgaccaaggtccattgggcgaagccgccattctggccctggctgatgcactcgacagc
tacattccaacaccagaacgcgcagttgacggcgccttcctgttgccagtggaagacgtg
ttctcgatctccggtcgcggcaccgttgtaacgggtcgtatcgaacgcggtatcgtcaaa
gtcggcgaatcgctggaaatcgttggtattcgcgacacccaagtcaccacctgtaccggt
gttgaaatgttccgcaaactgcttgaccaaggtcaggcaggcgacaacgtcggcgtattg
ctgcgtggcaccaagcgtgaagacgtggaacgtggtcaagttctggcgaagccaggttcg
atcaagccgcacaaacatttcacgggtgaaatctacgtattgtcgaaagacgaaggcggc
cgtcacaccccattcttcaacaactaccgtccgcagttctacttccgtactacggacgtg
actggttcgatcgagttgccgaaggataaagaaatggtgatgccgggcgacaacgtctcg
atcacggtgatgttgatcaacccgattgcgatggaagaaggtctgcgcttcgcgattcgc
gaaggcggtcgtaccgtcggtgccggtgttgttgccaagattattgagtaa

DBGET integrated database retrieval system