KEGG   Halanaerobium hydrogeniformans: Halsa_1304Help
Entry
Halsa_1304        CDS       T01349                                 

Definition
(GenBank) glutaredoxin 3
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
has  Halanaerobium hydrogeniformans
Brite
KEGG Orthology (KO) [BR:has00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Halsa_1304
Enzymes [BR:has01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Halsa_1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Glutaredoxin Pyr_redox GIDA GST_N_3 Thi4 HI0933_like NAD_binding_8 FAD_oxidored DUF836 FAD_binding_2 K_oxygenase FAD_binding_3 Thioredoxin_3 SH3BGR AlaDh_PNT_C GST_N_2 3HCDH_N NAD_binding_7 Thioredoxin_2 GST_N Pex14_N
Motif
Other DBs
NCBI-ProteinID: ADQ14731
UniProt: E4RKR1
LinkDB All DBs
Position
complement(1470114..1471301)
Genome map
AA seq 395 aa AA seqDB search
MKKELKIEVYSKDWCPYCKKAKAFLKSKGLEFEEININEADNYEIMKKRTSNKTVPQIII
NDKSLGGYDDIIELEKNGEFNQLIGRENIDYSEEEWELIILGAGPAALNASLYAARKGIK
VLLLTKDIGGQVINTDEIDNYLGKAGTTGADLVYDFWSHISKYDIKTVIGEKATAVNSKN
GQKIIKTDNDKEYLTKTVIIATGAKKRRLGMKQEYVLSGKGVHYCTNCDGFLYAEQAVAV
VGGGNSGLEGALDLAKIGCEVDLIEIEPSLMGDEYLQEKIYNSDKIEVHTSAKVSEINGE
EKLQSIVVESLNDSSQKELDVDALFIEIGLIANSDFVSDMVKLNQQKEIIINEKNETSEK
GIWAAGDVSNIMDKQIIISAAEGAKAALRVNQHLA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagaattaaagatcgaagtttattctaaagactggtgtccatactgcaaaaaa
gctaaagcttttttaaaaagcaagggtttagaatttgaagaaattaacattaatgaagcc
gataattatgagataatgaaaaaaagaacttctaacaaaaccgttcctcagatcatcata
aatgataaaagtttaggtggttatgatgatattattgaattagaaaaaaatggtgaattt
aatcagttaatcggtagagaaaatattgactattcagaagaagaatgggaattaataatt
cttggagctggacctgcagctttaaatgcctcactttatgcagccagaaaaggaataaaa
gttctactcttaactaaagatattggaggccaggtaattaatactgatgaaatagataat
tatttagggaaagcaggaacaactggagccgatcttgtttatgatttttggtctcatatc
agcaaatatgatattaaaacagttatcggagaaaaagcaactgcagtaaattcgaaaaat
ggccaaaaaataattaaaacagataatgataaagagtatctgactaaaacagtgataatt
gctaccggagcaaagaaaagaagattaggtatgaaacaggaatatgttttaagtggtaaa
ggggttcactactgtactaattgtgatggctttttatatgcagaacaagctgttgctgtt
gtaggtggagggaattctggtttagaaggtgcccttgatctggcaaaaataggttgtgag
gtcgatttaatcgagattgagccttctttaatgggggatgaatatttacaagaaaaaatt
tataatagtgataagatcgaagttcacacctcagcaaaagttagtgaaattaatggtgaa
gaaaaactgcagtcaatagtagttgaaagcttaaatgattcttctcaaaaagagcttgat
gtagatgcactttttatagaaataggtctaattgctaatagtgattttgttagtgatatg
gttaaattaaatcaacaaaaagagataattattaacgaaaaaaatgaaacatctgaaaaa
ggtatctgggcagctggagatgtcagcaatattatggataaacagattataatatcagct
gcagaaggtgctaaagcagctttgagagttaatcaacacttagcttaa

DBGET integrated database retrieval system