KEGG   Halanaerobium hydrogeniformans: Halsa_2089Help
Entry
Halsa_2089        CDS       T01349                                 

Definition
(GenBank) lipoic acid synthetase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00785  Lipoic acid metabolism
has01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:has00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    Halsa_2089
Enzymes [BR:has01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     Halsa_2089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM LIAS_N
Motif
Other DBs
NCBI-ProteinID: ADQ15506
UniProt: E4RJT6
LinkDB All DBs
Position
complement(2299124..2299972)
Genome map
AA seq 282 aa AA seqDB search
MKGKFPEWLKKRLPAQEKWMQVEDILDDLKLNTVCQSAHCPNQGECFANNTATFMILGKI
CSRNCRFCAVTSAEPEKVDPDEPANLAEAVKSLNLRYVVITSVTRDDLADGGVSQFIRVV
EEVKKIDKNIKVELLTPDFQGEEKILKRLAKAEFEVFNHNIETVPTLYNEVRPEADYQRS
LDVLEKMKNYKPSLYTKSGLMLGLGEKEVEVIKVMEDLREINVDILTIGQYLQPSKEHLE
VKEFIRPEKFAEYKKNGEKLGFKSVVSEPFSRSSYHASKSVE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtaagttcccggagtggcttaaaaaaagacttcctgctcaggaaaagtggatg
caggttgaggatattttagatgatttaaaattaaatactgtttgtcagagtgctcactgt
ccaaatcagggagagtgttttgccaataatacagcaacctttatgattttgggcaaaatt
tgttccaggaactgcagattttgtgcggtaacctcagctgagccggaaaaggttgatcca
gatgagccagctaatttggcagaagcagttaaaagtttaaatttacgatatgttgtgatt
acctcagtgacaagagatgatttagcagatggaggagttagccaatttattagggtggta
gaagaagttaaaaaaatagacaaaaatatcaaggtagaacttttaacacctgattttcaa
ggtgaagaaaaaatattaaaaagattggcaaaggcagaattcgaggtttttaaccataat
atagaaaccgtacctactctttacaatgaagtaagaccggaagctgattatcagcgctca
cttgatgtactagaaaaaatgaaaaattataagccttcactatatactaaatccgggcta
atgcttggcttaggtgaaaaagaagtggaagtaattaaagttatggaagatttaagagag
attaatgttgatattttaactatcggccagtatttacagccttctaaagaacatttagag
gtgaaagaatttatcaggccggagaaatttgcagaatataaaaagaacggggaaaaatta
ggatttaagtcagttgtttcagagcctttttctagaagttcatatcatgcttcaaaaagt
gttgaataa

DBGET integrated database retrieval system