KEGG   Halocynthiibacter arcticus: RC74_01040Help
Entry
RC74_01040        CDS       T04275                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
hat  Halocynthiibacter arcticus
Pathway
hat00240  Pyrimidine metabolism
hat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hat00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RC74_01040
Enzymes [BR:hat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RC74_01040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AML50052
UniProt: A0A126UVF5
LinkDB All DBs
Position
195640..196251
Genome map
AA seq 203 aa AA seqDB search
MAKLYFHFSTMNAGKSTILLQAAHNYRERGMDTYLLTARFDKRAGEGRIASRIGIGEDAD
TFETGEDLFAKIQARMLSGPCACVFIDESQFLEKEQVWQLARAVDDLRIPIMCYGLRVDF
QGELFPGSAALLALADEMREARTICYCGKKATMVIRQDDQGNVLKEGAQVQIGGNETYVS
LCRRHWRAAMGEDISRKYVKSVA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctattttcacttttcgaccatgaacgcagggaaatctacgatcctactg
caggccgcacataattatcgcgagcgcggcatggacacctatctgctgactgcgcggttt
gacaagcgcgcgggcgaagggcgcattgcctcgcgaattggcattggtgaagacgctgat
acgtttgagacaggcgaagatctctttgcgaaaattcaagcgcgtatgctaagcggcccc
tgtgcctgtgtgtttatcgacgagtcgcaattcctagagaaagaacaagtctggcaattg
gcccgtgccgttgatgacttgcgaattccgattatgtgttacggtctgcgtgtcgatttt
caaggcgaactgttccccggatcggcggcgctcttggctctcgcggacgaaatgcgcgaa
gcccgtaccatctgttattgcggtaaaaaggcaaccatggttatccgccaagatgatcag
gggaatgtgctcaaggaaggcgcccaagttcagattggcggcaacgaaacctacgtgtcc
ctatgccgccgtcactggcgcgcggccatgggcgaagacatctcgcgaaaatacgtgaaa
tcagtcgcttaa

DBGET integrated database retrieval system