KEGG   Halocynthiibacter arcticus: RC74_04470Help
Entry
RC74_04470        CDS       T04275                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
hat  Halocynthiibacter arcticus
Brite
KEGG Orthology (KO) [BR:hat00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    RC74_04470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AML50631
UniProt: A0A126UX40
LinkDB All DBs
Position
complement(893738..894508)
Genome map
AA seq 256 aa AA seqDB search
MENILADIPLWVLLIACLITVIAGFVKGAIGFAMPMIMISGLASVLSAEAALAALILPTV
MTNAAQALRQGLHEALQSAWRFRLYLGIVLVCIMGSAQLVTLMPQNAMFLMIGIPVLLFS
ITQILGWHLSIKKEHRKRAEVIIGCVAGFTGGLSGIWGPPTVAYLTAIGTEKQEQIRVQG
VIYGAGAVVLLLAHIKSGVFTVSTGSFSALMLAPALLGMLLGMRVQDRLDQAKFKKATLI
VLAIAGLNLIRRGVSG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaatatacttgcggacattcccctttgggtgcttctaattgcctgtttaataacg
gttattgcgggttttgtaaaaggcgccattgggtttgcaatgccgatgattatgatttcg
gggttggcatctgtcttgagcgccgaggctgcacttgcagcgctgattttgcccacggtc
atgacgaatgctgcacaagcattgcgacagggcctccatgaagcattgcaaagtgcgtgg
cgattccgactgtatttggggatcgttttggtctgcattatggggagtgcgcaacttgtt
acgctcatgcctcaaaacgcgatgttcttgatgatcggcattccagttttgctgttttcg
attacgcagattctgggttggcatctgtctatcaagaaggagcatcgcaagcgcgcagag
gtcatcattggatgtgtagctggctttaccggcgggctatctgggatttgggggccgccc
actgtggcctatctgacggccattggaaccgaaaaacaggagcaaatccgcgttcaaggc
gtcatctatggggcgggcgcggtggttcttttactcgcccatattaagtcgggcgtcttt
accgtaagtacgggctcgttttctgcgcttatgttggcacccgccctgttgggaatgctc
ttggggatgcgagttcaggatcgactcgatcaagcgaaattcaagaaggcgacgctgatc
gttttggcgattgcgggtctcaaccttattcgtcgtggggtgtctggttaa

DBGET integrated database retrieval system