KEGG   Herpetosiphon aurantiacus: Haur_0023Help
Entry
Haur_0023         CDS       T00614                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hau  Herpetosiphon aurantiacus
Brite
KEGG Orthology (KO) [BR:hau00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hau01001]
    Haur_0023
Enzymes [BR:hau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Haur_0023
Protein kinases [BR:hau01001]
 Serine/threonine kinases: Other
  Bacterial family
   Haur_0023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Pkinase_fungal Kdo RIO1 Seadorna_VP7 YrbL-PhoP_reg
Motif
Other DBs
NCBI-ProteinID: ABX02675
UniProt: A9B4B8
LinkDB All DBs
Position
28950..31190
Genome map
AA seq 746 aa AA seqDB search
MTDDLIGKQLANFRIDRVLGRGGMGLIYVGHDIKLDRPVAIKVIDGRYRQVPSYAERFVR
EARAIATWRHENIVQIYYADDTDNLYYFVMEYIDGVDLSKVLAQYTSTNSLLPHSAVMHI
ARSLASALDYAHKKGVIHRDIKPSNVMVAHDQRVVLMDFGLALDTQLGSQGEVFGTAHYI
APEQARRSADAIPQSDLYALGVMLYELLTGSVPFDDPSATSVALQHLTQPPPPPQEKNPK
LNNATAAVLLQALAKAPAERFQTGAELIAALEQALGITGSHQLAANANAAPGVRPPSQPG
ALGFATFDPEKPLEGQYLDGYRVEALLGRGGMANIFRGVDVRLNRTVAIKVIDTPFRNDQ
SYAERFNREAQAIAQLEHPNIVRLYHYGDSYGLLYMVMEYIEGDNLHKVIEQVRTSAQEW
TPRTLCRMIREVCAALDYAHSKGVIHRDVKPSNIMINKDGRAILADFGLALLTEVGTRGE
IFGSPHYVAPEQAISSAKVVAQTDLYSLGVILYELWTGQVPFDDADPLAIAMLHMAEPPK
APRSINPAISAQLEAVILKMLAKDPAERFPTGLDLAEALEAALGISSTGTGEYVRSQITP
VLDQAVNAPSTPAISNPTPPVVASEPKTPTTPTAPKTASQPIPNVIPAESVPTPPTPATK
YEKASSEPTKRRVQPLPPTPAAVAKAPEPTSAPTMPMPPADNTIREAPAPRLYTNRQQRS
NLLIMAIGVIVLITFIVIMWQLMSMI
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgatctgattgggaaacaactcgccaacttccgcatcgaccgcgttctaggc
cgtggtggcatgggcttgatttacgttggccacgatatcaagcttgatcggcctgtggca
atcaaggtgatcgatggtcgttatcgtcaagtgccaagctatgccgagcgttttgtgcgc
gaagcccgcgctattgccacgtggcggcacgaaaatattgtgcagatctactacgccgac
gatactgacaacctctattattttgtcatggaatatatcgatggcgttgatctctcgaaa
gttttagcccaatataccagcaccaacagcctcttgcctcatagcgccgtgatgcacatt
gcccgtagtttggccagtgcgctcgattatgcccataaaaagggcgtaattcaccgcgat
atcaagccatcgaatgtgatggtggcccatgatcagcgggtcgtgttgatggattttggc
ttggcgctcgatactcagcttggctcgcagggcgaagtttttggcacggcccactatatc
gccccggagcaagcacggcgttcggctgatgccatcccccaatcagatttatatgccttg
ggcgtgatgttgtatgaattgttgactggctcggtgccattcgatgatccttcggcaacc
agcgtagccttgcaacatcttactcagccgccgccaccgccccaagagaaaaaccccaag
ctgaataatgctacagcagcagtgttgctccaagctttagctaaagccccagccgagcgc
tttcaaacgggcgcagagctgatcgcagccctagaacaggctttggggatcacaggcagt
catcaacttgcggccaatgccaatgctgcgcctggagtgcgaccaccttcgcaaccagga
gccttgggctttgccactttcgaccccgaaaaacctttggaaggccaatatctcgatggc
tatcgggttgaagccttgctgggtcgtggtggcatggccaatatctttcgaggggttgat
gtgcggctcaatcgcaccgtcgcgatcaaagtgatcgacacgcccttccgcaacgatcaa
agctatgccgagcgtttcaatcgtgaagcccaagcgattgcccaacttgagcatcccaac
attgtgcggctctatcactatggcgattcatatggcctgttgtatatggtgatggagtat
atcgagggcgataatctgcacaaggtgatcgagcaagtgcggactagcgcccaagaatgg
actccacgcacactctgccgcatgattcgtgaagtttgtgctgctttggattatgcccat
agcaaaggcgttatccatcgtgatgtcaaaccatcgaatattatgatcaacaaagatgga
cgggcgattttggccgactttggcttggctttgctgaccgaagttggcacacgcggtgag
attttcggttcaccacactatgtcgcgcctgaacaagcgatttcttcggccaaagttgtg
gctcaaactgacctctacagcttgggcgtaattttgtatgagctttggacgggccaagta
ccatttgacgacgctgatccattggcgattgcgatgttgcatatggccgagccacccaaa
gccccgcgctcgatcaatccggcgatttcggcccaacttgaggcggtgattctcaaaatg
ttggccaaagatccggctgagcgcttcccaactggtttggatttagccgaagcgctcgaa
gcagccttgggcatttcatcgactggcactggcgaatatgtgcgcagccaaatcacgccg
gtgctggatcaagcggtcaatgcccccagcaccccggcaatttcaaacccaacgccgcca
gtggtcgccagcgagccaaaaactccaaccactccgactgcgcctaaaacggccagccaa
ccgattcccaacgtcattcctgcagagtcggtgccaacgccgccaacccccgcgaccaaa
tatgaaaaagcgtcttctgagccaactaaacggcgggtacagccattgccgccaacccca
gccgccgtggccaaagccccagagccaaccagtgcgccaaccatgcccatgccacccgcc
gataacaccattcgcgaagcaccagcgccgcgtttgtataccaatcgtcaacaacgcagt
aatctgctgattatggcgattggggtgattgtgctgattacgttcattgtgattatgtgg
cagttgatgagtatgatctag

DBGET integrated database retrieval system