KEGG   Herpetosiphon aurantiacus: Haur_2565Help
Entry
Haur_2565         CDS       T00614                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00260  Glycine, serine and threonine metabolism
hau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Haur_2565
Enzymes [BR:hau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     Haur_2565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Met_10 Methyltransf_25 2-Hacid_dh_C Methyltransf_11 MTS
Motif
Other DBs
NCBI-ProteinID: ABX05203
UniProt: A9B094
LinkDB All DBs
Position
complement(3288938..3290002)
Genome map
AA seq 354 aa AA seqDB search
MANNTMRAVQKPSAAPGAKLITAPIPQPKRDEVLIRVRASTICGTDLHIYKWDPWAQSRF
KAPMIFGHELAGDVVEVGSDVTMVKVGDFVSAETHIVCGYCYQCRTGAAHICRNVEIIGV
DRPGCFAEYIAVPAVNVWRNDPNMPPALAAAQEPFGNAVHTALATNLSTRNVLVTGCGPI
GLFAVGIAHAAGAKQIFATDINPKRLEMARTMGATHALDSRDDVVHHVLAATEGEGVDVL
LEMSGHPSAIDQGFRSLRYGGFASLLGLPPNGLPDFDLANHVVFKGATVYGVSGRKMFET
WYQTQALVAGNKVDLRPIITHHLPLEEFETAFELMLRGEAAKVALYPHGLDGAW
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataatacgatgcgggcggtgcaaaaaccatcggcagctccaggagccaagctg
atcactgcgccgattcctcagccaaagcgtgatgaagtgctgattcgagtgcgagcttcg
acgatttgtggcaccgacttgcatatttataaatgggacccgtgggcacaaagccgcttc
aaagcgccgatgattttcggccatgaattggctggcgatgtggtcgaggttggcagcgat
gtgacgatggtcaaggttggcgattttgtctccgccgaaacccatattgtctgtggttat
tgctaccagtgtcgcactggcgcagcccatatttgccgcaacgtcgaaattattggggtt
gatcggcctggctgtttcgctgaatatattgcggttccggcggtcaatgtttggcgcaac
gacccaaatatgccaccagccttggctgcggctcaagagccatttggcaatgcggtgcat
accgccttggcaaccaacctttcaactcgcaatgtcttggtgactggttgtggcccgatt
ggcttgtttgcggtggggatcgcgcacgcagcaggagccaagcaaattttcgccaccgat
atcaaccccaagcgcttagaaatggcgcgaaccatgggtgcaacccatgctttggattca
cgcgacgatgtggtgcatcatgtgctggcggcgaccgaaggcgaaggcgttgatgtgctg
ctcgaaatgtcgggccatcctagtgcaattgatcagggctttcgatcgttgcgttatggt
ggttttgcctcattgctgggtttaccacccaacggcttgcccgatttcgaccttgccaac
catgtggtgttcaaaggtgcgaccgtgtatggcgtttcaggccgcaaaatgtttgaaacc
tggtatcaaacccaagccttggtggcgggcaataaggtcgatttgcgtccgattatcact
catcacttgcctttggaagaatttgaaaccgcgtttgaattgatgctgcgtggcgaggct
gccaaagtggctttgtatccgcatgggcttgatggtgcttggtaa

DBGET integrated database retrieval system