KEGG   Herpetosiphon aurantiacus: Haur_2828Help
Entry
Haur_2828         CDS       T00614                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00500  Starch and sucrose metabolism
hau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Haur_2828
Enzymes [BR:hau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Haur_2828
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Haur_2828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ABX05466
UniProt: A9B2L5
LinkDB All DBs
Position
complement(3595193..3596839)
Genome map
AA seq 548 aa AA seqDB search
MQNDWYKDAIFYELHVRAFQDSNGDGNGDFRGLISRLDYLQSLGVDCLWLLPFYPSPGKD
DGYDVADYCNVHPSYGTMEDVVTFFEAAHSRGLRVMIDLVVNHTSDQHPWFQAARQPDSP
YRDYYVWSDTNQRYRDARIIFTDTERSNWAWDEVSESYYWHRFFSHQPDLNYENPAVLEE
MYNIMRFWLDRGVDGFRVDAVPYLIEREGTNCENLPETHVILRKMREFVDQHYPHCVLLA
EANQWPDDVRHYFGNDDEFHMAFNFPVMPRMFMAVRKEDSTPIIDIVRQTPKIPENCQWA
TFLRNHDELTLEMVTDEERDYMYREYAADPRMKINIGIRRRLAPLMDNARRRMELMNSML
LSLPGSPIIYYGDEIGMGDNIYLGDRNGVRTPMQWNGDRNAGFSAADFARLYSPVIIDPV
YGYQAINVEAQERVQSSLLNWMKRLIRVRKRYSVFGRGDIQILETQNRKVLAYLRSYADQ
TVLIVNNLSRFIQPVELDLAEFAGMRLVELIGETPFPAIATTPYFLSLAPHGFIWFRIEG
VRLALDDA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacgattggtataaagatgcaatcttttacgaattgcatgtacgagcttttcag
gatagcaatggcgatggcaatggcgatttccgtggcttgatttcgcgcttggattattta
caaagtttaggcgttgattgtttatggttattacctttttatccatcgcctggcaaagat
gatggctatgatgttgcagattattgtaatgtgcatcctagttatggcacgatggaagat
gtggttacatttttcgaggcagcccattcacgtggcttgcgggtaatgattgaccttgta
gttaatcacacctcggatcagcacccatggtttcaagcggcacgccaaccagactcgccc
tatcgcgattattatgtttggagtgatacaaatcagcgttaccgcgatgcacgaattatt
ttcaccgataccgaacgctcgaattgggcttgggatgaagtttccgaatcgtattactgg
catcgtttcttcagtcatcaacctgatttgaattatgaaaatcccgcagtcttggaagaa
atgtacaatattatgcgtttttggctcgatcgcggggttgatgggttcagagttgatgca
gtgccttacttaatcgaacgtgagggcacaaattgcgaaaatttgcctgaaactcatgta
attttgcgtaaaatgcgtgaatttgttgatcaacactatccacattgtgtactgctggct
gaggccaaccaatggcccgatgatgtgcgccattatttcggcaacgatgatgaatttcat
atggcctttaattttccagtgatgccacgcatgtttatggctgtacgcaaggaagatagt
acgccaattatcgatattgtacgccaaacgcctaaaattcctgaaaactgccaatgggca
acttttctgcgcaatcacgatgaattaactctcgaaatggtcactgatgaagaacgtgat
tatatgtatcgtgaatatgcggctgatccacgcatgaaaatcaatattgggattcgacga
cgtttagcacccttgatggataatgcacgtcgtcgtatggaattgatgaatagcatgctg
ttgagtttgccaggctcgccaattatttattatggcgatgaaattggcatgggcgataat
atttatcttggcgaccgcaacggcgtgcgtactccgatgcaatggaatggcgaccgcaat
gctggtttttcggctgccgattttgcccgtttgtatagccctgtgattattgatccggtt
tatggctatcaagcgatcaatgttgaggcgcaggagcgcgtgcaatcatcattattaaat
tggatgaagcgcttaattcgggtgcgcaagcgttattcagtctttgggcgtggcgatatt
caaattctcgaaacgcaaaatcgcaaagttttagcctatttgcgcagttacgccgaccaa
acggtgctgattgtcaataatctttcgcgctttatccagccagttgagctggatttggct
gagtttgcgggcatgcgcttggtggaattaattggtgaaacgccatttccggcaattgcg
acgacaccttattttctgtcgctagcgccgcatggctttatctggttccgaatcgaagga
gtgcgccttgctctcgacgacgcttaa

DBGET integrated database retrieval system