KEGG   Herpetosiphon aurantiacus: Haur_4237Help
Entry
Haur_4237         CDS       T00614                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00620  Pyruvate metabolism
hau00680  Methane metabolism
hau01100  Metabolic pathways
hau01120  Microbial metabolism in diverse environments
hau01200  Carbon metabolism
Module
hau_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Haur_4237
  09102 Energy metabolism
   00680 Methane metabolism
    Haur_4237
Enzymes [BR:hau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Haur_4237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABX06869
UniProt: A9AXE9
LinkDB All DBs
Position
5400885..5403674
Genome map
AA seq 929 aa AA seqDB search
MYTPETDRTPLSMLIHSLGNVLGDVIVAQDGVSAFELEEDVRQRTKQRRSDGTLQETQTL
TELISQLPVAQLMGLIKAFTHYFGLVNLAESVERLRVLAERDRQNGDAPRSESVELALQE
LRDRGITAQQVQDLLDHAEIRPVFTAHPTEAKRRTTLKKHHRIAGAARQLTADTTFQRQR
ERLLESIREEVISLWQSDEVRIIKPTVIDEVKNNLYYFEESLFDMIPQLYRDTEASLRQI
YPEHEWRVPAFLRFGSWVGGDRDGNPFVIPSVTVETLKLLMGRSLREHIHSVERLSHRLS
QSSRQVPISEELAQSLIHDAPLFPELAQVLERRNPHEPYRQKCSYIHAKLHATLAYVERY
EPDWARGGHRPAEGTWYANANQYLADLATMEYSLRTNGAASVADGFLRDIQCSAKVFGLH
TATLDIRQHSSRHTNALSEIFEYAGICDDYASLSQAERTAVLERELANNRPLIPTHLYYS
PETVEIIETFRTIRAVLSDLNAEAIETYIISMTEGPSDILAVLLLAREAGIYQPGEHSWL
NIVPLFETGADLIAAPEIMHTLLSSEAYRQHLVLRNDVQEIMLGYSDSNKDGGFADAHWA
LYLAQVALAETCFRHRVAMRLFHGRGGAVGRGGGPANRAILGQPPGTVGGRIKITEQGEV
ISDRYAEPETAYRHQEQIINAVLRSSLGVSIAHISQEWHDAMSSLAKVSRKVYRGLVYDH
PHFLEYFRNATPITEISRLNIGSRPASRKASDRIEDLRAIPWVFSWMQSRHTLPGWYGLG
SALEHLIQADANGLTTLQGMYNDWPFFRTMLDNAQMILSKADMDIAAQYALLVPDQALAN
EIFGLIKAEYTRTVKWICEVAQINELLDTSPILQHSIKQRNPYVDPLSFVQIELLRRLRT
DPDGLEHSDLEDAILLSINGIAAGLKNTG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgtatacacctgaaaccgaccgcacgccgctttcaatgctgatccattccctcgggaat
gtgcttggcgatgtgattgtggcccaagatggggtgtcagcgtttgagcttgaagaagat
gtgcgccaacgcaccaagcaacgccgaagcgatggaacattgcaagagactcaaaccctg
actgagttgattagtcaattgccagttgcccaactcatggggctgattaaggcctttact
cattattttggcttggtcaatttggccgaaagcgttgagcgcctacgagtgctggccgaa
cgcgaccgccaaaatggcgatgcaccacgctctgaatcggtcgaattggcattgcaagag
ttgcgtgatcgtggcattaccgcccagcaagtgcaagatttgcttgatcatgccgagatt
cggccagtttttactgcccacccgaccgaggccaaacgccgaacgacgctcaaaaagcac
catcgcattgcaggggcggcgcggcaattaaccgccgatacgacctttcaacgccagcgc
gaacgcttgctcgaatcaattcgtgaggaagtgatctcgctctggcaaagcgatgaggtg
cggattatcaagccaaccgtgatcgacgaagtgaagaataatctctattacttcgaagaa
tcgctgttcgatatgattccgcaactctaccgtgataccgaggcctcgttgcgccaaatt
taccctgagcacgaatggcgtgtgccagccttcctgcgctttggctcatgggttggcggc
gatcgcgatggcaatccctttgtaattccctcggtcacggttgaaacgcttaaactgttg
atgggccgttcgttgcgtgagcatattcattcagttgagcgcttgagtcatcgtttaagc
caatcgtcgcgccaagtaccaattagcgaagaattagcccaatcgctaatccatgatgcg
ccgttgttccccgaattggcccaagtgctggagcggcgcaatccgcatgagccatatcgc
caaaaatgctcctacattcacgccaaattgcatgccaccttggcctatgttgagcgctac
gagccagattgggcacgcggcggccatcgcccagctgaaggcacctggtatgccaatgcc
aaccaatatctcgccgatttagcaaccatggaatatagcttgcgcaccaatggcgcggcc
tcagtcgccgatggctttttgcgcgatatccaatgctcggccaaagtctttggtttgcac
accgccaccctcgatattcgccaacacagcagccgccacaccaacgccctgagcgaaatt
tttgaatatgcaggcatctgcgacgattacgccagcctgagccaagccgaacgcacggct
gtattggaacgcgagctagccaataatcgtccgttgattccaactcatctctactacagc
cccgaaaccgttgagattatcgaaaccttccgcacaattcgcgcagtgctttccgattta
aatgctgaggccatcgaaacttacatcatttcgatgaccgaaggcccaagcgatattttg
gcggtgctgttgctggctcgcgaggcgggcatttatcagccaggtgagcatagttggctg
aatattgtgccattatttgaaaccggagccgacctcatcgccgcgccggagataatgcac
acgctgctttcgagcgaagcctatcgccaacatttggtgttgcgcaacgatgtgcaagaa
attatgttgggctacagcgattccaacaaagatggtggttttgccgatgcgcactgggcg
ctctatctcgctcaagtggccttggccgaaacctgtttccgacatcgagtggccatgcgg
ctgttccatggccgtggtggggcggttggccgtggtggcgggcctgccaaccgtgcgatt
ttgggtcaaccaccaggcacagtcggtgggcggatcaaaatcactgaacaaggcgaagtg
attagcgatcgttatgccgagccagaaacggcctatcgccatcaagagcaaattatcaac
gcagtattgcgctcatcgttaggcgtgagcatcgcgcatatcagccaagaatggcacgac
gcgatgagtagtttggccaaggtttcgcgtaaagtctatcgcggcttggtctacgatcat
ccgcacttcttggaatacttccgcaatgctacgccgattaccgaaattagccgcttgaac
attggctcacgcccagccagccgcaaagccagtgaccggatcgaagatttgcgagcgatt
ccctgggtttttagttggatgcaaagtcggcataccttgccaggttggtatggcttgggc
agtgccttggagcatttaatccaagctgatgccaatggcttgaccaccttgcagggaatg
tacaacgattggccatttttccgcaccatgctggataatgcccaaatgattttatccaag
gctgatatggatattgcggcgcaatatgccctgcttgtgcccgaccaagccttagccaac
gaaatctttggcctgatcaaagctgaatacacccgcaccgttaaatggatttgcgaggtg
gcgcaaattaatgagctgctggatactagcccaattttgcagcactcaattaagcagcgc
aacccgtatgttgacccattaagtttcgtacaaatcgaattgctccggcgtttgcgcacc
gatcccgatggacttgagcatagcgatcttgaagatgcaattttgttaagtatcaacggg
attgccgcaggcttgaaaaatacgggttag

DBGET integrated database retrieval system