KEGG   Hafnia alvei: AT03_01475Help
Entry
AT03_01475        CDS       T03425                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hav  Hafnia alvei
Pathway
hav00620  Pyruvate metabolism
hav00680  Methane metabolism
hav01100  Metabolic pathways
hav01120  Microbial metabolism in diverse environments
hav01200  Carbon metabolism
Module
hav_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hav00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AT03_01475
  Energy metabolism
   00680 Methane metabolism
    AT03_01475
Enzymes [BR:hav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AT03_01475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF2764
Motif
Other DBs
NCBI-ProteinID: AIU71200
UniProt: A0A097QXJ7
LinkDB All DBs
Position
complement(301823..304459)
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKEALGENILDRVETIRKLSKSSRAGNDASRQELLTTL
QNLSNDELLPVARAFSQFLSLTNTAEQYHSISPHGEAASNPEVMAQLFTRLKNNNLSDEQ
IKKAVDDLSIELVLTAHPTEITRRTLIHKLVEVNNCLSQLDHSDLADYERNQIMRRLRQL
VAQSWHTDEIRKNRPSPIDEAKWGYAVVENSLWEGVPAFLREFNEQLENSLGYQLPVEAV
PVRFTAWMGGDRDGNPNVTADITRHALLLSRWKATDLFLRDIAVLVSELSMTECTPELRA
LAGGDDVQEPYRELMKKLRTQLTETQVYLAAKIKGERATRPDNLLVKNEQLWEPLYACYQ
SLKACGMGIIANGQLLDTLRRVHCFGVPLVRMDVRQESTRHSEALAELTRYLGLGDYESW
SEADKQAFLVRELNSKRPLVPRQWEPSAETKEVFDTCRVIAEAPQGSIAAYVISMARTPS
DVLAVHLLLKEAGCPYALPVAPLFETLDDLNNAEDVMTQLLSIDWYRGFIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQEALVNVCEKAGVALTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKLGLPQVTISSLSLYTNAILEANLLPPPAPKQEWRDLMDELS
DVSCDMYRGYVRENKDFVPYFRSATPELELGKLPLGSRPAKRKPNGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAALQAAVDEGKQSTLETMCRDWPFFSTRIGMLEMVFAKSDLWLAEY
YDQRLVDEKLWPLGKQLRDQLSKDIKVVLTIANDDHLMEDLPWIAESIALRNVYTDPLNV
LQAELLHRSRSLPEPDANVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattcggcaatgcgaagtaacgtcagtatgctagggaagctgctcggc
gacaccatcaaagaagcgctgggcgagaatatcctagaccgcgttgagactatccgtaaa
ttatcaaaatcctcacgtgcgggtaacgatgcaagccgtcaggaactgttaacgacgcta
caaaacttgtcgaatgatgagctgttgccggttgcccgcgcctttagccaattcctgagt
ctgacaaataccgccgagcaatatcacagcatttcccctcatggcgaagcggcaagtaac
cctgaagtgatggctcaacttttcacccgtttgaaaaacaacaatctcagcgatgagcag
atcaaaaaagccgtagacgatctctccattgagttagtcctcaccgctcatcctactgaa
atcacccgccgtaccctgattcataaactggttgaggttaacaactgccttagccagctc
gatcacagcgatttagccgactacgaacgcaatcaaatcatgcgtcgtctgcgccagtta
gttgctcaatcatggcataccgatgaaattcgtaaaaaccgtccatccccaattgatgaa
gcgaagtggggatatgccgtggtggaaaatagcctgtgggaaggggttcctgcattctta
cgcgaatttaatgaacagctagaaaactcattgggttaccaactaccggttgaagctgtg
cccgtgcgtttcaccgcatggatgggcggcgaccgtgacggtaatccgaacgtgaccgca
gacatcacgcgccacgctttattgttaagccgttggaaagccaccgacctgttcctgcgt
gatatcgccgtgctggtttctgaactatcgatgacagaatgcacgccagaactgcgcgct
ctggctgggggggatgacgttcaagaaccctaccgtgagctgatgaaaaaactgcgcacg
cagctgactgaaactcaggtttatctggccgcgaaaatcaaaggcgaacgcgcgacgcgc
ccagacaatctgctggtgaaaaacgagcagctttgggaaccgttgtacgcctgttaccaa
tcgctcaaagcctgcggcatgggtattatcgccaatggccagttgctggacacgttgcgc
cgcgttcactgcttcggcgtgccgctagtgcgcatggatgttcgtcaagaaagcactcgc
cactcggaagccttagcagagctcacccgttatttaggcctcggcgactatgaaagctgg
tcagaagctgacaaacaggccttcttagtacgtgaactcaactccaaacgcccactggtt
ccacgccaatgggagccaagcgctgaaactaaagaagtctttgatacctgccgcgtgatc
gcggaggcacctcagggctccatcgccgcctatgtgatttcgatggcgcgcaccccttcc
gacgttctcgctgttcatctgctattgaaggaagcgggctgcccttacgcgttacctgtt
gctccgctgtttgaaactctggatgacttaaataatgccgaagacgtgatgactcagctg
ttgagcatcgattggtatcgcggctttattcagggcaagcagatggtgatgattggctac
tctgactcagcaaaagatgcaggcgtgatggccgcatcatgggcgcaatatcgtgctcaa
gaagccttggttaacgtgtgcgaaaaagcgggcgtggcattgaccctgttccacggtcgc
ggtggttcaatcggtcgcggtggtgcaccggctcatgcggctctgctttcacaaccgccg
ggcagcttgaaaggcggtctgcgtgtcaccgagcaaggcgagatgatccgctttaaactg
ggtttaccgcaggtcactatcagcagtctatcgctgtataccaacgcaattctagaagcc
aatctgttgccaccgcctgcaccaaagcaggaatggcgcgatttaatggatgagttgtca
gacgtttcctgcgatatgtatcgtggctatgtacgtgaaaataaggacttcgtgccttac
ttccgctctgccacgcctgagcttgagcttggcaaactgcctttaggctctcgccctgcc
aaacgtaaaccaaacggcggcgtagaaagcctgcgcgctattccatggatcttcgcttgg
acgcaaaaccgcttaatgctgcctgcttggctgggtgccggtgctgcgctacaggccgcc
gtagatgaaggaaaacagtcaacgctggaaaccatgtgccgcgactggccgttcttctca
acccgcattggcatgctagaaatggtgtttgcgaagtcagatttatggctggctgaatac
tacgatcagcgcttggttgacgaaaaactgtggccgctaggcaaacagctgcgcgatcag
ctctcgaaagatatcaaagtggtactcaccatcgccaatgacgatcacttgatggaagat
ctgccgtggattgcagagtctatcgcgctgcgcaatgtgtataccgatcctttaaacgta
ctgcaggctgaattgctgcaccgttcacgctcgctgccggaaccggatgctaacgttgaa
caagcgctgatggtcaccatcgcaggcgttgcagccggtatgcgcaatacaggctaa

DBGET integrated database retrieval system