KEGG   Hafnia alvei: AT03_02740Help
Entry
AT03_02740        CDS       T03425                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hav  Hafnia alvei
Pathway
hav00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AT03_02740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hav02000]
    AT03_02740
Enzymes [BR:hav01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AT03_02740
Transporters [BR:hav02000]
 Other Transporters
  Pores ion channels [TC:1]
   AT03_02740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_3 GST_C_2 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: AIU71406
UniProt: A0A097QY35
LinkDB All DBs
Position
594353..595021
Genome map
AA seq 222 aa AA seqDB search
MITVHHLNNSRSHRVLWTLEELGLPYQIEQYQRDPVTMLAPESLKKIHPLGKAPVLTDGE
WTIAESAAILEYLQETYDHSALLKPQEKPERMQYRYWLHYAEGSLMPLLVMKLIFNRLGK
APVPWLIRPIGSLLGKGVQRGYLDQQLATHLRFIENHLSKNNWFAGDHFSLADIQMSFPL
EAMNIRTGLDKAPHARGLLKRLHARPAYQLALEKGGPMELMD
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattacggttcatcatcttaacaattcgcgttcccaccgtgtgctttggaccctagag
gagcttgggttgccctatcagattgagcaataccaacgcgacccagtaactatgttggca
cctgaatcgctgaagaaaattcacccgctgggcaaggctccggttctgaccgatggagag
tggaccattgcggaatcagccgccattcttgaatatcttcaagagacctatgaccattcg
gcgctgctaaagccacaagaaaaaccagagcgcatgcaataccgatactggctgcattat
gccgaaggatcgttaatgccgttattggtgatgaagctgatttttaatcgtttgggaaaa
gcgccggttccgtggctgattcgcccaattggaagcctgctcggcaaaggcgtgcagcgc
ggttatctcgatcagcaactggcgacgcatcttcgttttattgaaaatcatttgagcaaa
aataactggtttgctggcgatcattttagtctggctgatatacaaatgagtttcccactc
gaggcgatgaatatccgtactggtttagataaagcccctcatgcgcgtggtttattgaag
cgtttgcatgccagaccggcctatcagctggcgttagagaaaggtggcccaatggagttg
atggattag

DBGET integrated database retrieval system