KEGG   Hafnia alvei: AT03_06195Help
Entry
AT03_06195        CDS       T03425                                 

Definition
(GenBank) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
hav  Hafnia alvei
Pathway
hav00270  Cysteine and methionine metabolism
hav00450  Selenocompound metabolism
hav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AT03_06195
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AT03_06195
Enzymes [BR:hav01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     AT03_06195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Met_gamma_lyase Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIU72023
UniProt: A0A097QZX1
LinkDB All DBs
Position
complement(1341765..1342958)
Genome map
AA seq 397 aa AA seqDB search
MELRDKGYNTKIIHAGQHPDATTGALATPIFQTSTFVFENAKQGAARFALEEPGYIYTRL
GNPTQTALEEKIAMLEGGEAALATASGMAAISSTLLTLCGQGDHIVASEAIYGCTHALLS
HSMPKFGIEVTFVDAANIENIKAAIKPNTKVIYIETPANPTLSIIDIEQSAKLAHANDAL
LVVDNTFMSPYCQNPLKFGADIVVHSVTKYINGHGDVIGGVIVGDQEFINQARFVGVKDI
TGGCISPFNAWLTLRGLKTLAVRMERHCQNAMQVAKFLSSHSAVTKVYYPGLPEHPNYEL
GKKQMSNFGAVISFEIKGGVEAGQTVMDSVELCLLAVSLGDTETLIQHPASMTHSPMLPE
ERMKAGITDGLIRISVGLEDPEDIIADLEQAFNKAIY
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcgcgacaaaggctataacactaaaatcatccatgcaggacagcatcccgat
gcaacaactggtgcgctagccacccctatttttcaaacttctacattcgtattcgaaaac
gctaaacaaggcgccgctaggtttgcccttgaggaacccggatatatctacacacgcctt
ggaaacccaacgcaaacggctcttgaggaaaaaattgccatgttagagggaggtgaagct
gcgcttgccaccgcatcagggatggccgctatttcatcaacgctgctaacactatgcgga
caaggcgatcatatcgttgcttcagaggcaatatatggttgtacccatgcgttgttatcg
cacagcatgcctaaattcgggatagaagttacttttgtcgatgctgccaatatagagaac
atcaaagcagcaataaaaccgaataccaaagtgatttatattgaaacgcctgccaatcct
accttatccattatcgatatcgagcaaagcgccaaactcgctcatgccaacgatgcatta
ttagtcgtcgataacacgtttatgtcaccctattgtcaaaacccacttaaatttggcgcc
gatatcgtagttcacagcgtgactaaatatattaatgggcacggcgatgtaattggtggc
gtgatcgtaggtgaccaagaattcatcaatcaggcgcgctttgtcggcgttaaagatata
acaggtggctgcatcagtcctttcaacgcgtggctcacgctacgtggattaaaaacattg
gccgttcgcatggagcgccattgtcagaatgccatgcaggtggcaaaatttttatcctcg
cattctgccgtcacaaaggtttattatcccggcctgccagaacacccaaactatgaattg
ggcaaaaaacagatgtcgaattttggcgctgtgattagctttgaaatcaaggggggcgtt
gaagcggggcaaacagtgatggactccgttgagctatgcctgcttgcagtcagccttggc
gatactgaaaccttgattcagcatccagcctctatgacgcattcacctatgttaccagag
gaaagaatgaaagccggtattaccgatggcctaataagaatatctgtaggacttgaagat
cctgaagatatcatcgctgacctcgaacaagcctttaataaggcgatttattaa

DBGET integrated database retrieval system