KEGG   Hafnia alvei: AT03_13955
Entry
AT03_13955        CDS       T03425                                 

Definition
(GenBank) aminotransferase
  KO
K20429  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
hav  Hafnia alvei
Pathway
hav00541  O-Antigen nucleotide sugar biosynthesis
Brite
KEGG Orthology (KO) [BR:hav00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    AT03_13955
Enzymes [BR:hav01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     AT03_13955
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase
Other DBs
NCBI-ProteinID: AIU73381
UniProt: A0A097R3S9
LinkDB
Position
complement(2978972..2980072)
AA seq 366 aa
MKQIPVTQPHLPELSEFISYLEKIWDNKWLTNNGPFHQQLEKELCEYLGVKYISLFNNAT
IALITALQALRISGEVITTPYSFVATSHSIMWNGLKPVFVDICPETFNIDPKKIEAAITP
NTTAIMPVHCYSNPCDVETIQTIADNYGLRVIYDAAHAFGVNYKGKSILDFGDMSILSFH
ATKVFNTFEGGAIICQDEKTKQRIDRLKNFGIADELTVTAPGINGKMSEINAAFGLVQLK
HIDSAISQRAIIDQKYRDELKSIKGITVPKNSSDANSNHSYFPVLIEPEFRMTRDELYEE
LKAKNILSRRYFYPIISNMPMYRGIESAAVSNLPHSNSTSDKVLCLPIFNEMTKEDFERV
IAVIRG
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaaacaaattcctgtaacgcaaccacatctaccagaacttagcgagtttatttcttat
ttagaaaagatatgggataataagtggttaactaataatgggccatttcatcagcaatta
gaaaaagaactatgtgagtatctaggcgttaagtatatatctttattcaacaatgcgacg
atcgcacttattacagcattacaagcactgcgcatttccggcgaggtaattactactcca
tattcttttgtagcaacaagtcattcaataatgtggaatgggttgaaacccgtttttgtt
gatatttgtcctgagacatttaatattgatcctaaaaaaatagaggctgcaattacacca
aatacaacggccataatgccagtgcattgctattcaaacccatgtgacgtggaaactata
caaactattgctgataattatggtttgcgagtgatctatgacgcagcgcatgcatttggt
gtgaattataaaggcaaaagtattcttgattttggcgatatgtctattttgagtttccat
gcgacgaaagtttttaatacttttgaaggtggtgcaattatttgccaagatgagaagacc
aaacaacgaatagatagattgaaaaattttggtattgctgacgagcttactgttacagct
ccaggtattaatggaaaaatgagtgagattaacgctgcttttggcttagtacaacttaaa
catattgatagtgcaataagtcagcgagcaataatagatcaaaaatatagagatgagtta
aaatcaataaagggtattacggtacctaagaattcatccgatgcaaatagtaatcattca
tatttccctgtgttaattgaaccagagtttcgaatgacgcgagatgaattatacgaagaa
ctcaaggcaaaaaacattctttcgcgacgttatttttatccaataattagcaatatgcct
atgtatagaggtattgaatctgccgctgtatctaatctgccacactctaatagcacttca
gataaagttctctgtttgcctatttttaatgagatgacaaaagaagattttgagcgtgtc
attgctgttattcgaggttga

DBGET integrated database retrieval system