KEGG   Hafnia alvei: AT03_16025Help
Entry
AT03_16025        CDS       T03425                                 

Definition
(GenBank) exonuclease SbcC
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
hav  Hafnia alvei
Brite
KEGG Orthology (KO) [BR:hav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hav03400]
    AT03_16025
DNA repair and recombination proteins [BR:hav03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AT03_16025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SbcCD_C SMC_N AAA_29 AAA_21 ABC_tran cobW TsaE AAA_22 AAA_25 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AIU73744
UniProt: A0A097R4U8
LinkDB All DBs
Position
3456969..3460661
Genome map
AA seq 1230 aa AA seqDB search
MKILSLRLKNINSLKGEWKIDFTREDFANNGLFAITGPTGAGKTTLLDALCLALYHQTPR
LKVSPTQNELMTRGTAESLAEVEFEVKGVGYRAFWSQRRANNKPDGNLQTPKVELAHIAD
GEIITDKIQTKLHKIADITGLDFGRFTKSMMLSQGQFAAFLNADPAERAELLEELTGTEI
YGQLSEQIFQRFKQAKIDLDTLHERAAGVELLSEEALNQLSERLSELQREEQQQTSLRQT
LMTDLQWLQKSQELSQNREQCTQRVTAASQQWQTAQPEVLRLERSEPAEKLRPLLFTLHQ
TRADLASATQSQQQREQQRQQLTSQLALLQTASSQALHAKQQHQQQRTATETLINQHVVP
LDSRLTQIREDLLAQQQKLTQLSEEKQKQETALKQNREKLHAQQQEISQLQQQLADTAQH
AEWNNHLGRWKSQFEQSAEHCQSLNELRKRIADAEKNIATETEKLTALQQAGSLLNQRIA
QQQKNYADAELQHQQLEQKHSSAQLETQREKLHRGQPARQILIQISPLFEKSSLRQKQLH
AQSTQRTQELHALEQLLATKRLAYKEKRQHLNDLEKQIDLQRRVIGLEQERARLVAGDPC
PLCGSREHPAVKTYQTPALSDSEQRRDALRIEVENLSREGSELGERHKLMLQTQNQQQQE
IQAVEAEVMQYQQRWAQATAALELSLAIDDREGLESYLNEINQQEEALQNTLRQREMLSK
NWQLAKDALNSIQQEANQTLQQISLLELSTQTQSKQLNEWREDYGKQLAQQQHRDIALTD
ELHKLQLTAPVSGNEAEWLEQRSNEFTLWQQRQNHSQKLALENTRLMAEEHSLSQTCTAL
ETQWQTQHQLCSELETRLKQMQAERQSLLDGRSVDEVRRSLMETEQQVENQLQQAQQAEN
QIRQQLDKLGGELESAQQQRLLLEQRLSQQQTEFEQALANSQFTDEDTLIAALLDENELK
RLIALREQCKNQLSQAHAFLQQAESELAQWMTQRPENLDIHATLENLNQQLATLAEQLRE
NSVQQGQIQQQIRSDAERKQGQQSLFARIEQSRQEYEDWSYLNQLIGSSSGDKFRKFAQG
LTLDHLVYLANQQLARLHGRYLLQRKTSDALELEVVDTWQADAVRDTRTLSGGESFLVSL
ALALALSDLVSHKTSIDSLFLDEGFGTLDAETLDTALDALDTLNATGKMIGVISHVEAMK
ERIPVQIKVKKVNGLGISRLEVQYAVGSGE
NT seq 3693 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcctcagcctacggttaaaaaatatcaactcgctcaagggcgaatggaagatc
gatttcacccgtgaagactttgccaataacggcttatttgccatcaccggcccaaccggc
gcggggaaaacgacgctgctcgacgcactctgtttggcgctgtatcaccaaacgccgcgc
ttgaaagtgtcgccaacgcaaaatgagctgatgacacgcggcaccgccgaatcgttggcc
gaagttgaattcgaagtgaaaggcgtcggctatcgcgccttctggagccagcgccgcgcc
aataacaagccagatggcaatttacaaacaccaaaggttgagcttgcacatatcgccgat
ggtgaaatcatcaccgacaaaatccaaaccaagctgcataaaattgccgatattaccggt
ttagattttggccgtttcaccaagtcgatgatgctgtcacagggccagttcgccgccttc
ctcaacgccgatccggccgagcgggctgaattactggaagaactcaccggcaccgaaatt
tatgggcagctatccgagcaaatattccagcgtttcaaacaggcaaaaatcgatcttgat
accctgcatgaacgcgccgcaggcgtagagctgctcagcgaagaagcgcttaaccagctt
tccgagcggttgtctgaattacaacgtgaagaacagcagcaaacgtctttgcgtcaaacg
ctgatgaccgatctccagtggctgcaaaaaagccaagagctcagccaaaaccgagaacag
tgcactcagcgcgttaccgcggcatcgcaacaatggcaaaccgcccagccggaagtttta
cgccttgaacgcagtgaaccagctgaaaaactgcgtcctctattattcacgttacaccag
acacgcgctgatttagcatcagcaactcaaagccagcaacagcgtgagcagcagcgccaa
cagctgacttcgcagctagcgttactgcaaactgcgtcatcacaagcgctgcatgccaaa
cagcaacaccagcagcaacgtaccgccacggaaacgctgatcaaccaacacgtggtgcca
cttgattcgcggctgacgcagatccgcgaagacctgttagctcagcagcaaaaactcacg
caactcagtgaagaaaaacaaaagcaggaaactgcgctgaagcaaaaccgagaaaagcta
cacgctcagcagcaggaaatcagccaacttcagcaacagttggcagacacggctcaacac
gcggaatggaataatcacttaggccgttggaaaagccagttcgagcaatctgccgaacac
tgccaaagcttaaacgaactgcgtaaacgcattgccgatgcagaaaaaaacatcgccacc
gaaaccgaaaaactcacggctcttcagcaggcgggctccctactcaatcagcgtatagct
caacagcaaaaaaactacgccgacgcagaattacagcatcagcagctggagcagaaacac
agttcagcccagctagaaacacagcgtgaaaaattgcaccgcgggcaacctgcgcgccaa
attttgatacaaatcagtccactgttcgaaaaatcctcactacgacagaaacaactgcac
gcgcaaagtacgcaacgcacgcaagagctgcacgctctggaacagcttttagccaccaaa
cgcttggcttataaagagaaacgtcagcatctgaacgatctggaaaagcagatcgatcta
cagcgtcgagtgatcggactcgagcaagagcgtgcgcgtttagtggctggcgatccctgc
ccgctctgcggatcgcgggagcatccggcggttaaaacctaccaaacacctgcgctttca
gacagcgaacagcgccgtgatgcgcttcgcattgaagttgaaaacctcagtcgcgaaggc
agcgagctgggggagcgccacaagctgatgctgcaaacccaaaatcagcaacagcaagaa
atccaagccgttgaagctgaagtcatgcagtatcagcagcgctgggctcaggccacagcg
gcgctcgaactcagcttagcgattgatgaccgtgaggggctggaaagctatctcaacgaa
attaatcagcaagaagaagctcttcaaaacacactgcgccagcgagagatgttgagcaag
aactggcagctggcgaaagatgcgctgaacagcattcagcaagaagcgaaccaaacgctc
cagcaaatcagcctgttggaattgagcactcaaacacagagcaaacagctcaacgaatgg
cgcgaggactacggtaaacagttagcgcagcagcagcaccgtgacatcgcccttaccgat
gaactgcataaactgcagttaaccgcgcctgtctctggaaacgaagccgaatggctggaa
cagcgcagcaacgagtttacgctctggcagcagcgccaaaaccacagccaaaaactggcg
ctagaaaacacgcgcctgatggcggaagagcacagcctaagccaaacctgtaccgcactg
gaaacacagtggcaaacacagcatcagctttgttctgagcttgaaacccgcctgaaacag
atgcaggccgaacgccaaagccttctcgatgggcgcagcgtagacgaggtacgtcgttca
ttaatggaaactgaacagcaggttgaaaaccaacttcagcaagcgcaacaggctgaaaac
cagatacgacaacagctcgataaactgggcggtgagctcgaaagcgctcagcaacagcgc
ctgctgttggaacaacggctcagtcagcagcaaactgaattcgagcaggccctcgccaac
agccaatttactgatgaagatacgctgattgccgcgctgttagacgaaaatgaactcaaa
cggctgattgcgctgcgagagcaatgcaaaaaccaactctcgcaggcacacgcctttttg
cagcaggccgaaagcgaactcgcccagtggatgacgcaacgccctgaaaaccttgatatc
catgccacgctagaaaatctcaatcaacaactggctacgctagctgagcagctacgcgaa
aacagcgtgcagcaggggcaaattcagcaacagatccgcagcgacgccgagcgaaaacag
gggcagcaaagcctatttgcgcgtattgaacagagcaggcaagagtatgaagactggagc
tatctcaaccagctgattggctcgagcagcggcgataaattcagaaagtttgcgcagggt
ttaacattggatcatctggtctatttggctaaccaacagcttgcccgcctgcatggtcgc
tatttgctgcaacgcaaaaccagcgacgcgctggagctagaagtggtcgatacatggcaa
gccgatgcggtacgcgatacgcgcaccttatccggtggcgaaagcttcttggtgagtttg
gcgctggcgctggcactatccgatctggtcagccataaaaccagcattgattctctgttc
cttgacgaaggttttggcacgctggacgcagaaacccttgataccgcgcttgatgccctc
gatacgctcaacgcaaccggcaaaatgattggcgtcatcagccacgttgaagccatgaaa
gaacgtataccggtgcagataaaagtgaagaaggtgaatgggctagggatcagccgcttg
gaagtccagtatgcggtggggagtggggaataa

DBGET integrated database retrieval system