KEGG   Hafnia alvei: AT03_19075Help
Entry
AT03_19075        CDS       T03425                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
hav  Hafnia alvei
Pathway
hav00250  Alanine, aspartate and glutamate metabolism
hav00410  beta-Alanine metabolism
hav00430  Taurine and hypotaurine metabolism
hav00650  Butanoate metabolism
hav01100  Metabolic pathways
hav01110  Biosynthesis of secondary metabolites
hav01120  Microbial metabolism in diverse environments
hav02024  Quorum sensing
Module
hav_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AT03_19075
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT03_19075
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT03_19075
   00430 Taurine and hypotaurine metabolism
    AT03_19075
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AT03_19075
Enzymes [BR:hav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AT03_19075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIU74973
UniProt: A0A097R8A8
LinkDB All DBs
Position
4149991..4151271
Genome map
AA seq 426 aa AA seqDB search
MFNAVRDELMLDGNSRQNLATFCQTWVDEEIRDLMDLSIDKNMIDKDEYPQTAEIETRCV
HMLADLWNSPTPETTLGCSTIGSSEAAMLGGLALKWQWRKKRAALGLSTDKPNLICGPVQ
ICWHKFARYFDVELREIPLQGDRLIMSPEEVLKRVDENTIGVVPTLGVTFTCQYEPVKQV
HDALDQLQKETGLDIPMHIDGASGGFLAPFCAPDLEWDFRLPRVKSINASGHKFGLAPLG
TGWVIWREAADLPQELIFNVNYLGGDMPTFALNFSRPGGQIIAQYYNFLRLGREGYAKIH
NACYSTAQYLAQEIEKLGPFEMIFDGDCEKGIPALAWKLKDNASTNGYTLYDLADRLRSR
GWQVPAYSMPAEREDLVVQRILVRHGVSRDLGSLLIDDMKRALDYFEKHPVSHALSAKEA
GGFNHG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atttttaacgcagtgcgtgatgaattaatgttagacggcaactctcgtcaaaatttggca
accttttgccaaacctgggttgatgaagagattcgtgatctgatggatttatcaattgat
aaaaacatgattgataaagatgaatatccacagactgccgaaattgaaactcgctgtgtt
cacatgctagccgatctttggaactctccaacacctgaaacgacgctaggctgctctact
attggctcatcagaagccgccatgctgggtggattagcgcttaagtggcagtggcgcaaa
aagcgtgcggccttaggcctatcgactgataaaccgaacctaatctgcggcccagtacag
atttgctggcataaatttgcccgttattttgatgttgaactgcgtgaaatcccgctgcaa
ggcgaccgcctcattatgagcccagaagaagtcctgaagcgcgtcgacgaaaatacgatc
ggcgtagtccccacgctcggcgttactttcacgtgccaatatgaaccggtaaaacaggtt
cacgatgccctcgaccagttgcagaaagaaacgggtctggatatcccaatgcacattgat
ggcgcaagtggcggtttcttagccccattctgcgcacccgatcttgaatgggatttccgc
ctacctcgcgtaaaatccattaatgcttccggccacaaattcggccttgctccgctcggg
actggctgggtgatttggcgtgaagcggctgacctaccacaagaacttattttcaacgtt
aattatcttggcggcgacatgccaaccttcgcgctgaatttctcgcgcccaggcggccaa
attattgcgcagtattacaacttcttgcgtttaggccgcgaaggctatgccaaaattcac
aatgcctgttattcaacggcccaatacttagcccaagaaattgaaaaactaggcccattc
gaaatgatctttgatggtgattgcgaaaaaggcatccctgcacttgcttggaagctgaaa
gacaacgcctcaacaaatggctataccttgtacgatttggctgacagactacgcagccgt
ggttggcaggtgccagcctattccatgccggctgagcgtgaagacctcgtggttcaacgc
atcctcgtccgacatggcgttagccgcgacctcggtagcttattgattgatgatatgaaa
cgggcacttgattatttcgaaaaacacccagtgagccatgctctatcagcaaaagaagcc
ggtggatttaaccacggttaa

DBGET integrated database retrieval system